KEGG   Apteryx australis mantelli (brown kiwi): 106491504Help
Entry
106491504         CDS       T04298                                 

Gene name
ACTG1
Definition
(RefSeq) actin gamma 1
  KO
K05692  actin beta/gamma 1
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04145  Phagosome
aam04210  Apoptosis
aam04510  Focal adhesion
aam04520  Adherens junction
aam04530  Tight junction
aam04810  Regulation of actin cytoskeleton
aam05132  Salmonella infection
aam05164  Influenza A
Brite
KEGG Orthology (KO) [BR:aam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106491504 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    106491504 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106491504 (ACTG1)
   04520 Adherens junction
    106491504 (ACTG1)
   04530 Tight junction
    106491504 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106491504 (ACTG1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106491504 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    106491504 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aam03021]
    106491504 (ACTG1)
   03019 Messenger RNA biogenesis [BR:aam03019]
    106491504 (ACTG1)
   03036 Chromosome and associated proteins [BR:aam03036]
    106491504 (ACTG1)
   03029 Mitochondrial biogenesis [BR:aam03029]
    106491504 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aam04812]
    106491504 (ACTG1)
   04147 Exosome [BR:aam04147]
    106491504 (ACTG1)
Transcription machinery [BR:aam03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     106491504 (ACTG1)
Messenger RNA biogenesis [BR:aam03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106491504 (ACTG1)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     106491504 (ACTG1)
    NuA4 complex
     106491504 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    106491504 (ACTG1)
   PBAF complex
    106491504 (ACTG1)
   SWR1 complex
    106491504 (ACTG1)
Mitochondrial biogenesis [BR:aam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    106491504 (ACTG1)
Cytoskeleton proteins [BR:aam04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     106491504 (ACTG1)
Exosome [BR:aam04147]
 Exosomal proteins
  Proteins found in most exosomes
   106491504 (ACTG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 106491504
NCBI-ProteinID: XP_013806576
LinkDB All DBs
Position
Un
AA seq 375 aa AA seqDB search
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaattgcagcgctcgtcatcgacaacggctccggcatgtgcaaagctggc
tttgcaggagatgatgctccccgtgctgtgttcccctccattgttgggcgcccgagacac
cagggcgtcatggtgggcatggggcagaaggacagctacgtaggtgatgaggcccagagc
aagagaggaatcctcaccctgaagtaccccattgagcacggtattgtcaccaactgggat
gacatggagaaaatctggcatcacactttctacaatgagcttcgtgtggctcctgaggaa
caccctgtcctgctcacagaggctcctctgaaccccaaggccaacagagagaagatgaca
cagatcatgttcgagaccttcaacaccccagccatgtacgttgccatccaggctgtgctg
tccctgtatgcctctggtcgtaccactggtatcgttatggactctggggatggtgtcacc
cacactgtgcccatctacgagggctatgctctgccccatgccatcctgcgtctggacttg
gctggccgtgacctgacagactacctcatgaagatcctgacagaaagaggctacagcttc
actacaacagctgaaagggagattgtccgtgacataaaggaaaagctgtgctatgtcgcc
ctggacttcgagcaggagatggccactgctgcctcttcctcctccctggagaagagctat
gagctgcctgatggtcaggtgatcaccattggcaatgagcggttcaggtgtccagaagcc
ctcttccagccatccttcctgggcatggagtcttgtggcattcatgagaccactttcaac
tcaatcatgaagtgtgatgtagatatcaggaaggacctgtatgccaacacagtattgtcc
ggtggtaccacaatgtaccctggaattgctgacagaatgcagaaggaaatcacagctctg
gcacctagcacaatgaagatcaagatcattgccccacctgagcgtaaatactctgtctgg
attggtggctccatcctggcgtctctatcaaccttccagcagatgtggatcagcaagcag
gaatatgatgagtctggcccatccattgtccaccgtaaatgcttctaa

DBGET integrated database retrieval system