KEGG   Apteryx mantelli mantelli (brown kiwi): 106493955
Entry
106493955         CDS       T04298                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106493955 (CACNA1E)
   04020 Calcium signaling pathway
    106493955 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aam04040]
    106493955 (CACNA1E)
Ion channels [BR:aam04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106493955 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 106493955
NCBI-ProteinID: XP_013809531
LinkDB
Position
Un
AA seq 2102 aa
VMSCSSARDARIRHVLPQRSHAPRGQRPXADALVSRAASFDALYEPRSRDAEAGSAFDLG
LGPYVPVSPDVIKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGS
GDGGSDQNRSRQGPPAPAGGTPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGE
ENIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGI
FCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRV
LRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTN
NSEELDPPHPCGVQGCPPGYECREWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYN
VSQVFGSDFNTLLLVPLHLLGKYHLIPLIYGMLSCGGEFAKERERVENRRAFMKLRRQQQ
IERELNGYRAWIDKAGNPLSRSSIKGAKLNGASYFRHKERLLRISVRHMVKSQVFYWIVL
SLVALNTACVAIVHHNQPAWLTHFLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCF
DCGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSI
ISLLFLLFLFIVVFALLGMQLFGGRFNFIDGTPSANFDTFPAAIMTVFQILTGEDWNEVM
YNGIRSQGGVRSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAF
NQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRSSHLYVGHGVACCVWLVRFLC
ARVSGKDMSVFSRALARSPSPRAKRDKEPWHQKSCHGNCEPGEQDGGGGGIEDRARLRQS
QRRSRHRKVRTEGKEPAGALESCSASQETGLEEAGPAEGTQDGDRHGATAAAEDLMEGEP
EASQETARTNGVPAAELVGTTKEGSPRQTVPELGQGKNDSLTEQDCSSLDTSEQALLGSV
QLEASRAVSRSEPDLSSITTNTEKATESTTIMIDVQDSTVVQSEDLSLFPEPTHLSSSPG
LTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIF
AVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALL
TLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALII
ITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYT
IMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWN
IFDFITVIGSITEIILTDTKDSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKA
LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQ
EIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNF
EYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVA
YKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHL
SQKVLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSS
LPQEIISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQEIFQLACMDSTHGQFQEHQSLE
PEVREFQRVQPSNRGNYLPVDTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDK
RTNSSWLDEFSMERSSENTYKSRRRSYHSSLQLSARRLNADSGHRSDGHRSGGRERGRSK
ERKHLLSPDISRCNSEERSPQAHDESPERRRESRSPSEGRSQTPNRQGTGSLSESSIPSI
SDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAGDASPPPEESEGGSPLLSKALEPNAAC
LTESSSSPQGKQSRQSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTI
GS
NT seq 6307 nt   +upstreamnt  +downstreamnt
agtgatgagctgcagcagcgccagagatgctcggattcggcacgtgctccctcagcgctc
acacgctccccgaggccagcgccctntggcggacgcgctggtgtcgcgcgcggccagctt
cgatgccctctacgagccgcgctcccgggatgccgaggctggcagcgccttcgacctggg
cctcggcccgtacgtccccgtgagcccggacgttatcaagcgccggcgcggcgggctgat
cgagcagagggacatcatcaaggcgcacgaggctcacaagatgcagagcacgccgcaggc
gcggaggaaggagtgggagatggctcgctttggggaggcggtggctggcaggctgggctc
cggagatggaggctccgaccagaacaggagccggcaaggacctcctgcccctgcgggagg
caccccgggagccttcaagcaaaccaaagcgcagagagcccggactatggctctgtacaa
ccccatccctgtccggcagaactgcttcactgtcaacagatcgttgttcctctttgggga
agagaacatagtcaggaaatacgccaagaagctcatcgactggcctccctttgagtacat
gatcctggcaaccatcattgccaactgcatcgtgctggccctcgagcaacaccttccgga
ggacgacaagacgcccatgtcgcggagattagagaagacagagccgtacttcatcgggat
tttttgcttcgaagctgggattaagattgttgctcttggattcgttttccacaagggctc
gtacctgcgcaatggctggaacgtcatggacttcatcgtggtcctcagcggcatcctcgc
cactgctgggacgcacttcaacacacacgtggacctgcggaccctgcgggccgtgcgcgt
gctcagacctctgaagctcgtctcaggcattcccagtctacagatcgtgctgaaatccat
catgaaggccatggtgcctcttctccagatcggcttgctgctctttttcgctattctgat
gtttgccatcatcggcctggagttttacagtgggaagctgcaccgggcctgctacacaaa
caattcagaggagctggacccccctcatccgtgcggggtgcagggttgccccccaggtta
cgagtgccgggagtggatcggtcccaatgacgggatcacgcagttcgacaacatcctctt
tgctgtgttgaccgttttccagtgcattaccatggaagggtggaccacagtcctgtacaa
tgtgagccaggtctttggatctgatttcaacactcttcttttagttccattacacctctt
gggtaaataccatctgatcccactgatttatgggatgctttcatgtggcggggagttcgc
caaagagcgagagagagtggagaatcgccgagccttcatgaagctgcggcgccagcagca
gatcgagcgggagctgaacggctatcgtgcctggatagacaaagcaggtaaccccttgag
tcgctccagcatcaaaggtgccaaattgaatggcgcctcctatttccggcacaaagagcg
actcctgcgcatctccgtccgccacatggtgaaatcccaggtcttctactggattgtctt
gagcctggtggctctcaacactgcttgcgtggccatcgtccaccacaaccagccagcctg
gctcacccacttcctctactatgcagagttcctgttcctcggtctcttcctcctggagat
gtccttaaagatgtatgggatggggccacgcctttacttccattcttcgttcaactgttt
cgactgtggggttacagtgggaagcatcttcgaagtggtttgggctatcttcagaccagg
gacttcttttgggatcagtgtcctacgagccctccggctcctgcgaatatttaaaataac
caaatattgggcatccctgaggaatttggtggtctcactgatgagctccatgaaatctat
tatcagtctgctcttcctcctcttcctcttcattgtagtctttgccctgttgggaatgca
gctgtttggaggcaggtttaatttcattgatgggacaccttcagccaactttgacacttt
ccctgcagccatcatgacagtgttccagatcctgacgggtgaggactggaatgaggtgat
gtacaatggcatccgctcccagggaggcgttcgctcaggcatgtggtcctccatctattt
catcgtcctcaccttgtttggaaactatactctgctgaacgttttcttggccattgctgt
ggacaacctggccaatgctcaggagctcaccaaggatgagcaggaggaagaggaggcctt
taaccagaagcacgcccttcagaaagccaaagaagtcagcccaatgtccgccccaaacat
gcctgctatcgaaagagacaggcgaaggagacaccacatgtcgatgtgggagccacgcag
cagccacctgtatgtgggccacggggttgcgtgttgtgtgtggctcgtgcgcttcctgtg
tgcgcgtgtgtcagggaaggatatgtctgtcttctccagggcgcttgcgaggagcccgtc
gccccgcgccaagcgggacaaggagccgtggcaccagaagtcgtgccacgggaactgcga
gccgggcgagcaggacgggggcggaggggggatcgaggacagagcccggctgagacagag
ccagcggcgtagccggcaccggaaagtgaggaccgaggggaaggagcccgccggggccct
ggagagctgctcggccagccaggaaacgggtctggaggaagccggccccgcggaggggac
gcaggatggggaccggcacggggccactgctgcagcggaggacctgatggagggggagcc
ggaggcgagccaggagactgcgaggacaaatggggtccctgccgctgagctggttgggac
caccaaagagggaagcccccggcaaactgtgcccgagctggggcaggggaagaatgacag
cctcaccgagcaggactgcagcagcctggacaccagcgaacaagccctgctgggcagcgt
gcagctggaggcaagtcgcgccgtgagcaggagcgagcctgacctctcctccatcaccac
caacaccgagaaggccacggagagcaccaccatcatgatcgatgtccaagactccactgt
ggtacagagtgaggacctgtctctctttcctgagcccactcatctcagctcctctcctgg
cctgaccaacaaaggccgggatatcaagaccatcaagtctctccgtgtgctgcgagtctt
gaggcctctgaaaaccatcaagcgactgcccaaacttaaggctgtctttgactgcgttgt
gacttcgctgaagaacgtcttcaatatccttattgtctacaagctcttcatgttcatctt
tgctgtcattgctgtccagctcttcaaggggaaatttttctactgtactgacagctctaa
ggacacggagaaagactgcatagggaactatgtggaccacgagaagaacaagatggaagt
gaagtgccgggaatggaaacgccatgaatttcactatgacaatataatctgggctttgct
tactctgttcacagtctccactggtgaaggctggccccaggtgctgcaacattcggtgga
tgtgacggaggaggaccgcgggcccagccgcagtaaccgcatggagatgtccatttttta
tgttgtctattttgtggtcttccctttcttcttcgtcaacatttttgtggctctcatcat
catcacgttccaagagcaaggagacaaaatgatggaggagtgcagtctggagaagaacga
gagagcctgcattgactttgccatcagtgccaagcccctcacgcgctacatgccacagaa
ccggcataccttccagtaccgggtctggcactttgtggtctccccatcctttgagtacac
catcatggccatgatagcattgaacactgtggttctgatgatgaagtactattctgctcc
atatacctatgagctggccctgaagtacctgaacatcgcgttcaccatggtgttctcctt
ggagtgtgtcctcaagatcattgcttttggcttcctgaattatttccgggacacctggaa
catctttgacttcatcactgtcatcggtagcattacagagatcatcctgacagacaccaa
ggatagcagcttcaacatgagctttctgaagctgttccgggctgctcggctcatcaagct
gctccgccagggttacactatccggatcctgctctggacttttgtacagtccttcaaggc
cctcccgtatgtctgcctcttgattgcgatgctttttttcatctatgcgatcattgggat
gcaggtttttgggaatatcaaactcgatgaggaaagccacattaaccgtcacaacaactt
ccgcagtttcttgggctccctgatgctccttttcaggagtgccacgggagaggcatggca
ggagatcatgctgtcctgcctggagggcaaaggctgtgagccagacaccacggcaacatc
tggacagaacgagaacgagcgctgtggcactgacctggcctacgtttacttcgtctcctt
catcttcttttgctctttcctgatgctcaatctgtttgtggcagtcatcatggacaattt
tgaatacctgactcgggattcctccatcctgggacctcaccatctagatgagtttgtccg
gatctgggcagagtatgacagagcagcgtgtggccgaatccattacactgagatgtatga
aatgctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaggtggc
ctataagagactggtgctgatgaacatgccagtggctgaggacatgacagtccacttcac
ctccaccctgatggcgctgatacgcacagccctggacatcaaaatcgccaaaggtggtgc
cgactggcagcagctggactctgagcttcaaaaggagatcctgaccatttggcctcatct
gtcccagaaagtgcttgacctgttggtacccatgccaaaaacctctgacctgactgttgg
caaaatatatgcagccatgatgatcatggattactacaagcagagcaaagcgaaaaagca
gaggcagcagctggaggaacagaaaaatgctccaatgttccagcgcatggagccttcctc
tttgccgcaagaaatcatctcaaatgctaaggctctgccttatctccagcaggacaccct
ctcgggcctgagcagccgtagtgggtttccctcgctgagcccactctcgccgcaggagat
tttccagctggcatgcatggattcgacgcatgggcagttccaggagcaccagtccctgga
gccagaggttagggagtttcaaagagtgcagccctctaaccgtggcaactaccttcccgt
ggacactcaggaccacgctgtatctgggagggcctcctccatgcctcgtctcactgtgga
tccccaggtggtcacggacactagttccatgcggcgatcgttttccaccatccgcgacaa
gcgcaccaacagctcctggctggacgagttctccatggagcggagcagcgagaacaccta
caagtcccgccggcgcagctatcactcctcgctccagctctccgcccgacgcctcaacgc
cgactcgggccacaggtctgatggccatcgctcaggcggcagggagcgggggcgatccaa
agagcgcaagcacttgctgtccccggacatctcccgctgcaactcggaggagaggagtcc
ccaggcgcacgacgaatctccagagaggcggcgtgagtcccggtcacccagcgagggcag
gtcgcagacacccaacaggcagggaacgggctccttgagcgaaagctccatcccctccat
ctcggacaccagcaccccccggcgaggccgccgccagctcccgccggtgccccccaagcc
acgtcccctcctctcctatgcctccatgctgcggcacgctggagacgcctcgccgccccc
cgaggagagcgagggggggtccccgctgctctccaaggccctggagcccaacgctgcctg
cctgaccgagtcttccagctccccccaggggaagcagagccggcaatccaccccgcagcg
ctacatctcggagccctacctggccctgcacgacgactcgcacgcctcggactgcgggga
ggaggagacgctcaccttcgaagcggccgtcgccaccagcctcggccgctccaacaccat
cggctcg

DBGET integrated database retrieval system