KEGG   Apteryx australis mantelli (brown kiwi): 106494860Help
Entry
106494860         CDS       T04298                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106494860 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aam03036]
    106494860 (KMT5B)
Enzymes [BR:aam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106494860 (KMT5B)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106494860 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 106494860
NCBI-ProteinID: XP_013810647
LinkDB All DBs
Position
Un
AA seq 857 aa AA seqDB search
MKWLGESKNMVVNGRRSGSKSSNDHPQNQTKLQHAGKENPKTGKNGVERRSSRCSGASGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIER
FKKDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRY
SSEQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQL
WLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYT
CERRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDAD
TTQEKANATNRKSSIGVKKNGKSRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKP
AKPLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAV
SSGCLTRHAAREYKLNSVKGAHEHGDIPPCTYITRRSMRTRMNLKETSDIKLEPNMLDSY
KNNLTRTRSDVLEQQSHAINESDLAHGTSHKGEGRCQKNDAGMSKKKSRQGKLVKPSAKI
EETDLTHNTPVKDEVPDLISSHSEHGERNNVVDTPVSYKDCIPGSGGCSVVTSDNFKAKD
SFRTAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQENDGMNSSKISIKL
SKDHEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREEENKGTYPEDLHENGMCCSETLS
LLESRMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSID
IDISSRRREDQSLRLNA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtggtgaatggcaggagaagtggaagcaag
tcgtctaatgaccacccacagaatcagaccaaattgcagcacgcgggaaaggagaatccg
aagactggcaaaaatggagttgagagaagatcaagcagatgtagcggtgcttcaggattt
gagggccaaagtcgttacgtgccttcctcgggaatgtctgccaaggagctgtgtgaaaac
gatgacctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatg
aatactagatttcgacctataaaaggaaggcaagaagaactaaaagaggtgattgaacgt
tttaagaaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcc
cggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtattt
atttatttacgaatgtttgcaactgacagtgggtttgagatactgccttgtaaccggtat
tcttctgagcaaaatggagccaaaattgttgcaacgaaagaatggaaacggaatgataaa
atagaattacttgtgggctgtattgctgaactatcagaaatggaagaaaacatgctgctg
agacatggggagaacgacttcagcgtcatgtattccacacggaaaaactgtgctcaactg
tggcttggtcctgctgcatttatcaatcatgattgcagacctaactgtaagtttgtatca
actggcagagatacagcatgtgtgaaagctctaagagatattgaacctggagaagaaatc
tcttgttattatggagatggctttttcggagagaataacgaatactgcgaatgttacacc
tgtgaaagacgtggaactggtgcttttaaatcaagagtgggattgccagcacctactcct
gtgattaatagtaaatatggactgagagaaacagataaacgattgaacagacttaaaaag
ttgggtgacagcagcaaaaattcagacagccaatccgtcagctctaacactgatgcagat
accactcaggaaaaagctaatgcaactaacagaaaatcttcaattggcgtaaaaaagaac
ggcaagagtagaacattaacgagacagtctatatcaagaattccagcatcatcaaattct
acctcatctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcct
gcaaagcctttactttcaaagatcaagttgagaaatcagtgcaaaaggccagagcaaaag
aatgcttctagaaagctcgagatgggaaatctagttctcaaagagcctaaagtagttctg
tataaaaacttgcccattaaaaaggataaagaattggagggaccagtcaaagttgcagtc
tctagcggatgcttaacaaggcatgcagccagagagtataaactgaattctgtgaaaggt
gctcatgagcatggtgatataccaccctgcacatacataacaaggaggtcgatgagaaca
aggatgaatttgaaggagacctctgacataaagcttgaaccaaatatgttggatagctat
aaaaataatttgaccagaacgcgatcggacgttttagagcagcagtctcatgcgataaat
gaaagcgacctggctcatggaacatcgcataaaggggaggggaggtgccagaaaaatgat
gcaggcatgtcaaaaaagaaatcccgacaaggaaaacttgtgaaaccatccgcaaaaata
gaagaaactgatcttacgcacaatacacctgttaaagatgaagtaccagatttgatcagc
tctcattcagagcacggagaaaggaataatgtagtggacacacctgttagctataaagac
tgtatccctggatctggtggctgctctgttgtgacatctgacaattttaaagcaaaggac
agctttagaactgcaaaaagtaaaaagaaaagacgaatcacgaggtatgatgcacaatta
attcttgaaaatagctctgggatccctaaactgactcttcgtagacgccatgatagcagt
agcaaggcaaacgaccaagaaaatgatggaatgaattcttcaaaaataagcatcaaatta
agtaaagaccatgaaaaagataataatttatatgtagcaaagctaaataatgggtttaac
tcaggatcaggcaatagttcaacaaaattaaagatacagctaaaacgagaggaagaaaac
aaagggacgtaccctgaggaccttcatgaaaatggtatgtgttgtagtgaaactctctcc
cttttggagtcgagaatggaagtagatgattatggtcactatgaagaggaaacagcagat
gaatcttcatcagaagaggatgatgaagaggaggatgactatgatgatgaatttgatgac
tttattcctcttcctccagcaaagagattaaggctcattgttggcaaggattcaatagat
attgatatttcttccaggaggagagaagatcagtctttaaggctcaatgcataa

DBGET integrated database retrieval system