KEGG   Apteryx mantelli mantelli (brown kiwi): 106495210
Entry
106495210         CDS       T04298                                 

Gene name
GOLGA2
Definition
(RefSeq) golgin A2
  KO
K20358  golgin subfamily A member 2
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aam04131]
    106495210 (GOLGA2)
Membrane trafficking [BR:aam04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    106495210 (GOLGA2)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C Uso1_p115_C GIT_CC
Other DBs
NCBI-GeneID: 106495210
NCBI-ProteinID: XP_013811088
LinkDB
Position
Un
AA seq 1052 aa
MLGEGTFHLDFRFLFFFPQLKEYQQKNSPGATAGAKKKRKTKEGSRPETPTNDDRQSPEN
IQNILKVLVSDLNRSNGVAIPSLDKRKAYFDSDVATCNAEQLAADVPVLSNSNSLPSCGS
VLPAPGSMQLTQIHETEDHKNALDENRSLSSTESLRQLSEQLNGLVSQSTSYVNGESAVS
STNIKEMETRYQELAVALDSSNLTNKQLITKIEELKQQNQEAMNQLEKEKKEFEQKFSKE
QAALREQLQVHIQTIGILVSEKSELQMALGHTQQAARQKSGEAEDLAARLQSSRQRVAEL
ERTLSSISMQQKQSEKHNKELVKERDNLKLELYKQSKGSEELKQQNSELSEKLRSLVSEN
SAMKLDMEDLHKKLEMAELMIQQFSNQSGSLDANQQLQIALEERASLETQIAQLSESLHQ
LQAERDQYVEKLKEEGSIWQQRVQQLSEQVHTMAEEKEKHVTQIRELEANVTELLSKSAV
KPMDIEPSSPAGPTEAELSLQEEVQRLQQEKEELHGQYQAQVRDNEQLSHLNREQEEQLL
ELEKAVQRYSEESVDRQQILESMQSDKATISRALSQNRDLKEQLAELQNGFVKLTNENME
VTSALQSEQHVKKELAKKLGQLQENLGELKETLELKTQEARGLQDQRDQYYSHLQQYTVA
YQQLAAEKEELHKQYLLQTQLMDRLQHEEVQGKVTVEMHLKELQQTKESLEAVAKENKEL
QAQISQLAAELDGRMLHRIEGDGVESEAMIEENQKSSFVIPENFESHEEMVAFLTSAMSQ
VEKEREDMRQQLAAQKQQCRSLLQQVAALRQEQQHSVTLSGDSAMDTVPVEVHEALKTAM
EKLQSRFTDLMREKADLKERLEELEHRCIQLSGETDTIGEYIALYQSQRAILKQRHQEKE
EYISRLAQDKEEMKVKLLELQDLVMRLVGERNEWYSKYVAAAQNPELLASQNDSMLPVER
RIELNATDGEGLREVSLSDEPEQEAVLQQSSFSPIDSKAAQPNQEDPTAKQIMQLLREIQ
NPQERLGSLPENPCIPFFYRADENDEVKIMVV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgctgggagaaggaacattccatttggacttcagattcttgttcttttttccacagctg
aaggagtatcagcagaagaatagccctggagcaactgcgggagccaagaaaaaaagaaaa
actaaagaaggaagtagacccgagactcccacaaatgatgaccgacagtctccagagaac
attcagaacattctgaaggtgctggtgtcagaccttaaccgctccaatggggtagccata
ccctcattggacaagaggaaggcatactttgacagtgatgttgccacttgtaatgctgaa
cagcttgctgccgatgtccctgtgctatctaacagcaacagtctgcctagttgtggttct
gttctgcctgctcctgggagcatgcagctgacacagattcatgaaactgaagatcataaa
aatgctttggatgagaacaggtctctttcatcaacagaaagtctccgccagttgtccgaa
cagctcaatggcctggtttctcagtctacgtcatatgtgaatggagaaagtgctgtttct
tccacaaatattaaggaaatggaaacacgttaccaggagctggcagtagccctagattcc
agcaatctaactaacaaacagctcattacaaagatagaggaattgaaacagcagaaccaa
gaagcaatgaatcagctggagaaggaaaagaaggagtttgaacagaaattttctaaagag
caagcagcactgcgggaacagctgcaggttcatattcagactattggaattctagtttct
gagaagtctgagttgcagatggcccttggacatactcaacaagctgcacggcagaaatca
ggagaagctgaagaccttgctgctcgtttgcagtcatctcgccagagggtagcggagcta
gaacgcaccttatcctccatctctatgcaacagaaacagtcggagaagcataataaagag
ttagtgaaggaacgagacaacctgaaactggaactgtacaaacagagcaaaggtagtgag
gaactaaagcagcagaactcagaactgtcagagaaactccgctctctggtttctgagaac
tcagccatgaagctggatatggaggatttgcataagaaactggaaatggctgaactgatg
atccaacagttctcaaatcagtcagggagcctggatgccaaccaacagttgcagatagca
ctggaggagagggcaagcctggaaacgcagattgctcagctctcggagtcacttcaccag
ctgcaggcagaaagagatcaatatgtagagaaactgaaggaggaggggagcatttggcag
cagcgggtacagcagctctcggagcaggtccacacaatggcagaggagaaggagaagcat
gtgacccaaattcgggagctggaagccaatgttacagaactgttgagcaaatcagcagtt
aagcccatggatattgagccttcctcaccggcagggcccacagaggctgagctgagcctg
caggaagaggtccagcggctgcagcaagagaaggaggaactgcatgggcaataccaggct
caggtccgggacaatgagcagctgagccacctcaacagggagcaggaggagcagctgctg
gagctcgagaaggctgtgcagcgctacagtgaagagtctgtggacagacagcagatcctg
gagagcatgcagagtgacaaggccacaatcagtagggctctgagccaaaaccgggacctg
aaggagcagctggctgaattgcagaatgggtttgtcaaactgacaaatgaaaacatggag
gttacgagtgccctacagtcagagcaacatgtaaagaaggagctggccaagaagcttggg
cagctgcaggagaacctgggggagctcaaagagacgctggaactgaaaacacaggaagct
cggggactgcaggaccagcgggaccagtactacagccacttacaacagtacactgtggca
taccagcagctggctgctgagaaagaggaactgcacaagcagtacttgcttcagacacag
cttatggatcggctacagcatgaggaggttcaggggaaggtgactgtggaaatgcacctg
aaggagctgcagcagactaaggaaagtctggaagctgtggctaaggaaaacaaagagctg
caggcccagatcagtcagttagcggcagagctggatggcaggatgttgcaccgaatagaa
ggagatggagttgaaagtgaagcaatgattgaagaaaaccaaaaatcttcatttgtgatc
ccagagaactttgaaagccatgaagaaatggttgctttcttgacatctgccatgtcccaa
gtggagaaggagcgagaagatatgagacaacagctggctgctcagaaacagcaatgcaga
agcctcctgcagcaagtagcagctcttaggcaggagcagcaacatagtgtcacactgagt
ggagattccgctatggatactgttccagtggaggttcacgaggctttgaaaactgccatg
gagaaactacagtcccgtttcacagacctgatgcgtgagaaagctgatctgaaggaacgg
ctagaagagctagaacatcgctgcatacagctgtctggggaaacggacaccattggggaa
tatattgcattataccagagtcaaagggctatcctcaaacagcggcaccaagagaaagag
gagtacatcagcaggttggctcaggataaggaagagatgaaggtgaagttattggagctg
caggacttggtgatgcgcctggttggggaaagaaatgaatggtacagcaagtacgtggca
gctgctcagaacccagagctgttagcaagccagaatgacagtatgcttccagtggagagg
cgcattgaactgaatgctactgatggagaagggttacgggaggtgagtttatcagatgaa
ccagaacaggaggctgttcttcagcagtccagtttctcccctattgacagtaaagctgct
caaccaaaccaagaggaccccacagcaaagcaaataatgcagcttctcagagaaatccag
aaccctcaggagaggctgggctccctgccagaaaacccctgcattcccttcttctaccgt
gctgatgagaatgatgaggtcaaaatcatggtggtttaa

DBGET integrated database retrieval system