KEGG   Apteryx australis mantelli (brown kiwi): 106495649Help
Entry
106495649         CDS       T04298                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04210  Apoptosis
aam04625  C-type lectin receptor signaling pathway
aam04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106495649 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106495649 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106495649 (MAP3K14)
   04672 Intestinal immune network for IgA production
    106495649 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106495649 (MAP3K14)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     106495649 (MAP3K14)
Protein kinases [BR:aam01001]
 Serine/threonine kinases: STE group
  Other
   106495649 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 106495649
NCBI-ProteinID: XP_013811614
LinkDB All DBs
Position
Un
AA seq 944 aa AA seqDB search
MAVMGITCQGAPDPNIKHKKELTATKGLNETVSEKQSSVCKVEDSKKVAFHSPWKILNDV
ITKGTAKEETEGGSASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKSRKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ETHQSTLYRNNFWVSELGKDLVYDPLLFEKPGKVLSAGKLHSPRSQYKAELHKLISPVQC
LNHVWKRHYQRDSVPQPETLHPFPYNIIPPHFPPLDSPLHAMKLNALGTYFRGDFNYQDS
EHRLSGLNLECSFPRCVNQSMKTSSDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEQFQEADENEGVLLNEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKADNVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLITGNYVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTTVALEEVGGVTS
PWKGEYREPRHLALNKENNQQTSLSPTVSPVSETDSDPKLAVKVSCASPVLPPPSLEQTE
EVEGTPWNLCKELSGIWDPPPLSSLAPLPLKSFSHAERATTISEQELQQLEIELFLNSLS
QPYSLEEQEQMLSCLSIDSPFVSDASEKNSLKASHSLRDTMSSGIHSWNSQTDGQSFSWN
NLLNRSRHTDTPSYFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVT
KEGQPVHYDMEVPDSGIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccaaggagctcctgacccaaacatcaagcacaagaag
gagctcacggctacaaaggggctgaatgagacagtgagtgaaaagcagagcagtgtttgc
aaagtagaagattcaaagaaggtcgcctttcacagtccttggaaaatcctgaatgatgta
atcaccaaaggaacagcaaaagaagaaacagaaggaggctctgcatcaatttctattatt
gcccaagcagaatgtgaaaacagtcaagagttcagccctactttatcagagagatccttc
attgctcatagtaagcgttacagccggtcagacagtcttgatcaaatccctaacaatgtg
gctcacgcgacggaggggaaaatggcacctacctgttggagggggaggcatcgtggtaaa
agcagaaagaaacgtcataagaaaagatccaagctgaaaatacaaacagtggccgctggc
aggcgtggtcccagaactccagaacaagaaagctgcaccccaattccagtccaggaggat
gaaacacaccaaagtactctctacagaaacaatttttgggtttcagaacttggcaaggat
ttggtctatgatccgctgctgtttgagaaacctgggaaagttctgtccgcaggcaaactc
cattcaccaaggagtcagtacaaagcagaactgcacaagctgattagccctgttcagtgc
cttaatcatgtttggaaacgtcactatcagagggacagcgttccacagcctgaaacgctt
catccttttccatacaacataatacctcctcatttcccacctctggacagtcctctccat
gccatgaaacttaatgctctgggaacatacttccgtggtgacttcaattatcaagacagt
gagcatcgcttatctggcctaaacttagaatgcagtttccccagatgcgtcaaccagtcc
atgaaaaccagttcggacaagatttctgtggaagaatacttggtagacgccttgaagggg
agcgtgagtctcggtgaaccgcaaaatttagccagcctagccaagacgtggagaggaggc
ggtctggacctgaaggaacaattccaagaagcagatgaaaatgaaggcgtgctccttaat
gagaaactaaagccagtggattacgagtaccgagaagaggttcactggaccaagtgtcac
ggttctttgggcattggttcttttggagaagtatacaaaatagaggacaagcagacagga
tttcagtgtgctgccaaaaaggtacaagttgaacacttccgtgcagaggagttaacaaca
tgtgctgcaataacaagtcctaaagttgtccccttgtatggagcagtgaaggaagggcct
tgggtgactatcttcatgaagctgatggagggtggctctctgggtcagctgattaaacag
agcggctgcctgccagaggacagagctcttagttatctgggccaagctttagagggcttg
gagtatcttcatgctcaaaacattcttcatggagatgtaaaagcggacaatgtgctctta
tctgatgatggaagcagggctcttctctgtgattttggtcactctgctcaccttcatcca
gatggcttgggaaagtgcttgatcacagggaactatgtacctggcacagagactcacatg
gctccagaggtggtcatgggaaagcgctgtgactctaaagtggatgtctggagcagctgc
tgtatgatgctgcacatgctcaacgggtgccacccttggacccagtattacaatcatcct
ctctgtctaaagatagctaaagagccacctcctctgagggaaattccgccttcctgcaac
cctctcactgctgagattattaaaatgggtctggagaaagagcctgttcagagagcatct
gcatctgaactgaaaactaagaccacagttgcacttgaagaagtgggaggtgtgacaagc
ccctggaaaggtgaatacagagagcctagacatctagctttgaacaaagaaaacaatcaa
cagacctccctgtcccccacagtgagcccagtttctgagactgattctgacccaaaattg
gcagtcaaagtttcttgtgcaagcccagtcctaccgccaccatctctggagcaaacagag
gaggtcgagggaaccccttggaacctgtgcaaggagttatctgggatctgggatcctcca
cctctctcttcattggctcctctgcccctgaagagcttcagccatgcggagagagcaaca
accatttcagaacaagagctgcagcagctggaaatagaactgttcttgaacagcctgtca
cagccttactcgctggaagagcaagaacaaatgctttcatgtctcagtatcgacagccct
tttgtgtcagatgccagtgagaagaactccctgaaggcctctcatagcttgagggacacc
atgagctctgggattcattcctggaacagccagacagatggacagagtttcagttggaac
aacctgctgaatcgcagtcgacacacggacactcccagctatttcaatggagtaaaaatc
cagattcagttgctaagtggagaaaatctacacatcagggatttccacaggacaaaggtg
ggagacattgccactgggataagcagccagataccggtccctgctttcagtctggtgacg
aaagaaggccagccagttcactatgacatggaggtcccagactctggtattgagttgcag
tgcaccctcgcccctgactgcagcgtcagctggacatggagagtcaagcatgggcaactg
gagaacaggccatga

DBGET integrated database retrieval system