KEGG   Apteryx australis mantelli (brown kiwi): 106495668Help
Entry
106495668         CDS       T04298                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aam00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    106495668 (SETD1B)
Enzymes [BR:aam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106495668 (SETD1B)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106495668 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     106495668 (SETD1B)
    COMPASS/SET1 complex (yeast)
     106495668 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 106495668
NCBI-ProteinID: XP_013811635
LinkDB All DBs
Position
Un
AA seq 1982 aa AA seqDB search
MSFREIKAGEKAKHPEDHGKKQSSRLASWWISSLPGCVERAYKLIIDPALKKGQHKLYRY
DGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPPKQVTFAKL
NDNIRENFLTDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQHLHNTSVM
GNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDVSPTVNETLQLTDSLKRLKDS
SLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSYSQYTPQSQGTPHTPRLGTPFSQDSTY
SSRQTTPVYHFGQDSGYKPRRHETKFTDAYNRRPGHHYVHNSAGVFRGTEHQFSTFKSHQ
QEPVQFSHTPPLSHSGSSSYKSAFSPYQAPAVFPQSDEQQFPQTSRETEYRRPAPPPAEM
VVESSAATNIDFVPVKEKQEEPPPLPDSNSVPESSTATFSQTPERSETPGTPTMESEMQH
NSLDSRIEMLLKEQRTKLPFLNEHDSDNEVRMEGSPISSSSSQLSPIPMYSSNSQPGYRA
QTPSSRPSSTGLEDISPTPLPDSDDDEPIPGTASLSQNSRAASEASMTPVDPLSRTSKTE
TSEVKEMVPGDQTPTSEKMDEGQHSSGEDMEISDDEMNPAPITSAECAKTIVVNSSVSNT
AVMAPSIPMPPPGFPPLPPTHPAVTVPPPPLPAPPGVPPPHILPPLPPFHPGMFPVMQVD
MISVLGNQWGGMPMSFQMQTQMLSRMMQGQNTYQYPPFMGGRMQFLNLPPYRPFSMGAAL
GRGQQWPPLPKFDPSVPPPGYEPKKEDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVV
AFRAFDDWWDKKERLAKASLTPVKSGGELEEKPKPKDRITSCLLENWNKGEGLGYEGIGL
GIGLRGAIRLPSFKVKRKEPPEAASAGDQKRIRPSTSVDDEDEESERDRDASDVTSDLSK
KDAEAVGLRRRPARPLELDSEGEEGDETSGKEEESSSEKEEEQEEEGSLVKAAPGKEEEE
DEDEDEEDEDEEEDEEDDEDEEDDDEETGIETSDKEEEQDSEEEDVASPSSSKAEVESSD
ESEDSSEFESSSDSDDEEEEEDEDEEEEEEEEEDEEELAEDQDREALVAETEHEPASHEV
PDDERETILDLYPVDDFMDATGLGLAEPALAEKDEGMEEVKAGESECGEVPEESIAAETL
LVIERDQETKLALSPICGPEEESEPVTMLEPEVQEGLKPESQDEEAAALCLSTPVGVFGE
PLPNKSSFFSKSDDSNLEARVKAKLPSAAEEEDRLPRTPGREVVVHSETDTLLFPAHKVP
SSTLPLPSTPGKEESLVPPEKFPEQLMVTKTPVEEEIPRTPGRDILAKSSHPLAKSQSTD
TVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSHSPGINSGIPRTPGRDFNFTPTFPEAG
ATIPCLLSGKKQSEDELDEKPFKEPLGASLMVSMNSVPSPIPFASPPQADFHTDMGLTPD
EPIPVAALPCMPGDGRMAIEECKAEVKSVLLSSEAPTGASILPPPPPPSVLPKRRPGRPK
RSPPSVLSLDVYSGKTIEPPPVPVALVESAVSKELLSGHPDAFYGLKDPEAVTLDFRNDG
FHEKITAETVTEKLPFKELENQWNEDFKEEEAHVKPKRQWRRQKKTPEDIPVIPSPEYSP
PRPQFRPRSEFEEMTILYDIWNGGIDEEDIKFMCITYDRLLQQDNGMDWLNDTLWVFHPS
TSFSTPKKKKRDDGMREHVTGCARSEGYYKIDKKDKLKYLNNSRAFAEEPPADTQGMSIP
AQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAM
EPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFI
NHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGT
LN
NT seq 5949 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgagagatcaaggcgggggaaaaagccaagcaccctgaagatcatggcaaa
aagcagagttcaaggcttgcttcttggtggatttcctccctgcctgggtgtgttgagcgg
gcgtacaagttgattattgacccggctctgaaaaaaggacagcacaaactctatcgttat
gatgggcaacattttagcatgcctaactcgggaatcgctcctgtggattgtgtcagagat
cccagaatagggcgaatatggaccaaaactaaggagttggagctgtctgttcccaaattc
aagatcgatgaattttacgtggggccagtgcctcccaagcaggtcacctttgccaagctg
aatgacaacatccgcgaaaactttttgaccgacatgtgcaagaaatacggcgaagtggaa
gaggtggagattctctacaaccccaagaacaagaagcacctgggcattgccaaagtgatc
tttgccactgtcaagggtgcccgggaggccgtccagcaccttcacaacacctccgtcatg
ggcaacatcatccacgtggagctggatacaaaaggtgaaacccgcatgcgattctatgaa
ctgctagttaatggtctttacactcctcagacccttcccgtaggcaccgagcaggacgtg
tcgccaactgtgaatgaaactctgcagttgacggattctctaaaacgcctgaaagacagt
agtctttcttctgcgggatcatctgttacccccaacagtagcacgccgttttcccatgac
acagcctattccagctgtcggcaagacaccccaaactcatacagccaatataccccccag
tcccaaggaacacctcacaccccacggctagggacgccgttttcccaagattccacctat
tctagtcgtcagacaacgcctgtgtaccattttgggcaggacagtgggtacaaacccagg
aggcatgaaacaaaatttacagatgcctacaaccgtcgaccgggacatcactatgttcat
aattcggcaggcgttttccgagggacagagcatcagtttagtacgttcaaatctcatcag
caagaaccagttcagttctctcacactcctcccttgagccactctggttcttcaagctac
aaatctgccttctctccctaccaagcaccagctgtttttccccagtctgatgagcaacag
tttccccaaacttcgagggaaacagagtaccgaagacctgcgccacctccggccgagatg
gttgtagaaagtagtgctgccactaatattgattttgttccggtgaaggaaaaacaggag
gaacctccacccctgccagattcgaactctgttcccgaatcgagtacagcaaccttctct
cagactccagagaggagtgagacccccggcaccccaaccatggaatcggaaatgcagcat
aacagtttagactcaaggattgagatgctcttaaaagagcagagaacaaagttacccttt
cttaatgagcatgactcagataatgaggtccgaatggaaggtagccctatctcctcttcc
tcttcccagctttctcccatcccaatgtacagttcgaactctcagcctggttacagagct
caaacaccatcttcgcgcccttccagcacgggcttggaggacatcagcccaacgccgctg
cctgactccgatgacgacgagcccatccctgggacagcttctctgagtcagaattccagg
gcagcgtcggaggccagcatgactcctgtcgatcccctgagcaggacctccaaaactgag
acctcagaggttaaagaaatggtgcctggtgaccagactccaacatcagaaaaaatggat
gagggtcagcattcttcaggggaggacatggagatctccgacgacgagatgaatcctgcg
cccatcaccagtgcagaatgtgccaaaaccattgtggtgaactcctccgtcagcaacaca
gccgtgatggctccatcgatccccatgcccccgccgggatttcctccccttccgcccacg
caccccgccgtcaccgtccctccgcctccgctgcccgcaccccctggggtccctccgcct
cacatcttgcctccgcttcctccgttccaccctggcatgttcccagtcatgcaagtggat
atgataagtgtcctgggcaaccagtggggtggcatgccaatgtccttccagatgcaaact
cagatgctgagccgcatgatgcagggacaaaacacgtaccagtatccgcctttcatgggg
ggccggatgcagtttttgaatcttccgccctaccgccccttctcaatgggagcagcgctt
ggtcgtggacagcagtggccaccactgcccaagtttgacccctcggttccaccaccgggt
tacgagccgaagaaggaggatccccacaaagctactgtggatggagtcctcctggtcata
gtgaaggaactaaaggctatcatgaaaagggacctgaaccggaagatggttgaagtggta
gcatttcgggcgtttgatgactggtgggacaagaaagaacgtctggcaaaggcatctctc
actccagtgaagtctggaggagaactggaggagaaaccaaagccgaaggatcggatcaca
tcttgtctcttggagaactggaacaaaggagaaggcctgggatatgaaggaatcggcttg
ggcattgggttacgaggggccatccggttgccatccttcaaggtgaaaagaaaggagcca
cctgaagctgcctcagcaggagatcagaagagaatccggccttctacttctgttgatgat
gaagatgaagaatcggaaagggacagagatgcttccgatgtgacatctgatctgtcaaag
aaggatgcagaagcagtggggttgaggcggcgaccagcacggcctctggagctggacagc
gagggggaggagggagacgagacatcgggtaaagaggaagaatcctcctcagagaaggaa
gaagagcaggaggaagagggaagcttggtgaaagcagcacctggcaaggaggaagaggag
gatgaggatgaggacgaggaggatgaggacgaggaggaggatgaagaggatgatgaggat
gaagaggatgatgatgaggagacaggaatagaaacaagtgacaaggaagaagagcaggac
tccgaggaggaagatgtagcaagtccctcatcttccaaggctgaagttgagtcatctgac
gaaagtgaggactcctctgaatttgagtcgagctccgactcagatgatgaagaggaggag
gaggatgaagatgaagaggaggaggaggaggaggaagaggacgaggaggagctggctgaa
gatcaagatagagaagccttggttgctgagacagagcatgaacctgccagtcatgaggtc
cctgatgacgagagggagaccattttggatctgtatcctgtggacgacttcatggatgca
acaggcttgggactcgcagagccagctttggcagaaaaagatgaaggcatggaagaagtc
aaggcaggggaaagtgaatgtggtgaagtcccagaggaatctattgctgctgaaacactc
ctggttatagaaagagaccaggagacaaaacttgcgctgtctcccatctgtgggccagag
gaagagtccgaaccagttaccatgctagagccagaggtacaggagggtctgaagcctgaa
tctcaagatgaggaggcagcggcgctctgtctctcgactccagtgggagtctttggagaa
cctctacccaataaaagcagcttctttagcaagtctgatgacagcaacttagaagcccgt
gttaaagcaaaactgccctctgcagcagaggaagaagaccggctgcctcggacgcctggg
cgggaggtggtggtccattcagagactgatactcttctgtttccagcccacaaggtgcca
tcctccacgctccccttaccatcgactcctggtaaagaggaatccttagtccctccagaa
aagttccctgaacagttaatggtgaccaaaacacccgtggaagaggagattcctaggact
cctgggcgggacattttggccaagtcttcacacccccttgcgaagtcacagagcacagac
actgttccagccaccccaggaagcgatgctcccctaacgggaagcagcttgaccctcagt
tctcctcaagtcccagggagccccttttcctacccgtcccactctcctggcattaacagt
ggcattcctcggactcctgggagagatttcaatttcacgcctactttcccagaggctggt
gctaccattccttgccttctgtctggcaagaaacagtcagaggatgagctagatgagaaa
ccctttaaagagcctcttggtgcttcccttatggtcagcatgaacagtgttccttcccct
atcccttttgccagccccccacaagcagatttccacacagacatgggcctgacacctgat
gagccaatacctgtagcagccctgccctgcatgcccggagatggaagaatggccatcgag
gaatgcaaggcagaagtaaaatctgttttgctctcatcagaagcacccacgggtgcttct
attcttcctcccccaccaccaccttctgttcttcccaaaaggaggccaggtcggccgaaa
cggtcaccaccttctgtcctctcgctggatgtctactcgggcaaaaccatagaacctcct
cctgtcccagtggccttggtggaaagtgctgtgagcaaagagctgttaagtggacatcct
gatgctttctatggactgaaagaccctgaagccgtcaccctggatttcaggaatgacggt
ttccacgagaaaataacagctgagacggtcacagagaaactgccatttaaggaactggag
aaccagtggaatgaagacttcaaagaagaagaagctcatgtgaaacctaaaagacagtgg
cgaaggcagaagaagacacctgaggacatcccagtgattccttcccctgagtattcccca
ccccggcctcagttcagaccacgctccgagtttgaggagatgaccattttgtatgatatt
tggaatggaggcatagatgaggaagatatcaaattcatgtgtatcacatacgaccgcttg
ttacagcaggacaatggtatggactggctcaacgacaccctgtgggtattccatccttca
actagcttttctactcccaagaaaaagaagcgggatgatgggatgcgggagcatgtgacg
ggctgtgcacgaagtgaaggctattacaaaattgataagaaggacaaacttaaatacctc
aacaatagccgagcttttgcggaggagcctccagctgacacgcagggtatgagcatccct
gcccaacctcacgcttccacccgggctggctccgagaggcggtcagagcaacgcagactc
ctctcctccttcaccggtagctgtgacagcgacctcctcaagttcaaccaactcaagttc
cggaagaaaaaactaaaattctgcaagagccacattcatgactggggcctttttgctatg
gagcccattgcagctgatgagatggtgattgaatacgtgggtcagaacatcaggcaggtc
atcgctgacatgcgtgaaaagcgatacgaggatgaaggcattgggagcagttacatgttc
agagtcgaccacgacaccatcatcgatgccacgaagtgcggaaactttgccaggtttatt
aatcacagctgcaatccaaattgttatgctaaagtgatcaccgtggagtctcaaaagaag
atcgtcatctactcaaaacagcacatcaatgtgaacgaggaaattacctacgactacaag
tttccgatagaggatgtaaaaatcccgtgtctatgtggctctgagaactgcaggggaacc
ctaaactga

DBGET integrated database retrieval system