KEGG   Apteryx australis mantelli (brown kiwi): 106495941Help
Entry
106495941         CDS       T04298                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aam03036]
    106495941 (HDAC10)
Enzymes [BR:aam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106495941 (HDAC10)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106495941 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl EVI2A
Motif
Other DBs
NCBI-GeneID: 106495941
NCBI-ProteinID: XP_013811968
LinkDB All DBs
Position
Un
AA seq 682 aa AA seqDB search
MASGTALIYDEEMTSHKLLWNDPICDIEVPERLSFSYEQLKCYHLVERCVCVPAREGSEE
EILLVHSSEHLEVAKSTQTMNEEELKRVSGNYDAFFFHPSTYRCARIAVGAGLQLVDSVM
SGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKRKYGLQRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGRGKGSNINLPWNKVGMGNSDY
LAAFFHVLLPVAFEFDPELVLVSSGYDSGIGDPEGQMNATPDVFAHLTHFLMQLANGKLC
VILEGGYHLKSLSESVCMTVKTLLGDPVPQITGEMAPCLSAIESIQNVRAAHKPYWKCLM
YEDTSFLQNLSTKSHLLEKVNTNPSTEHESKITNKDEMVKVERFLELHMKNILFPVPPIK
TAATIESEASAHLLPLSVRVVKEMDMNEVKALVSAFYADLVKEDETLLSLGSMLAVLDKI
LTKQVCNGIAESPTASVSVAVALRHSVRFGFQRVLCIFVGDMEIIPNTEDGRILMIHICE
KQQSEKTNSKHYISLNWKEGAEGNDFFSAVFGFILPVAYSYQANLTVIAVGPNRSLGING
ISLLFGLLRGLAESRILAVIENTEMNLMQSVAKALVGDSTPDFGVYAPPTQEKVRKIKIL
RDQLQQEWKMLQCSVKNGISGN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagcattgatttatgatgaggaaatgaccagtcataaactactttgg
aatgatccaatttgtgatatcgaagtgccagaaagactgtcattctcttatgagcagctt
aaatgttaccatcttgtggaaagatgtgtctgtgtgcctgccagagaaggaagcgaggag
gagatcctgttggttcacagttcagaacacttggaagttgcaaaaagcacccagacaatg
aatgaagaggaactgaaaagagtctctgggaattatgatgcttttttctttcatccgagc
acttaccgctgtgccagaatagcagtaggagcaggtttgcagctggtagactctgtgatg
tcaggaaaagtgtgcaatggaatggcattagtaaggcctccaggtcaccacagccagagg
aatgcagctaatgggttctgtttattcaacaatgttgctattgcagcagaatatgcaaaa
agaaaatatggtctacagagaatcctaattgttgactgggatgtgcaccacgggcaagga
actcaatatatatttgaagaggatccaagtgttttgtatttttcctggcatcgctatgaa
catcaggaattctggccatcactcaaggaatctgattatgatgctgtaggtctgggacga
ggaaaaggaagtaatataaatttgccttggaataaggttggcatgggaaattcagattat
cttgctgctttttttcatgtcttgcttccagtggcttttgagtttgatcctgaactggtt
cttgtgtcctctggatatgattcaggaattggagaccctgaaggtcaaatgaatgccact
cctgatgtttttgcccaccttacccacttcctgatgcagctagctaatggaaagctgtgt
gttattctggagggtggataccatttgaagtcactgtctgaatcggtctgcatgactgta
aaaactttgcttggagatcctgtacctcaaataactggagaaatggcaccttgcctaagt
gctattgaatctattcaaaatgtgagagcagcacataaaccctactggaaatgtttgatg
tatgaagacacatcttttttacaaaatctgagcaccaaatcacacctactagagaaggtt
aatacaaatccctccacagaacacgagtctaagataaccaacaaagatgaaatggtcaaa
gtagaaaggtttttggaattgcacatgaaaaatattctatttccagtgcctcccatcaaa
acagcagcaacaattgagtctgaagcttcagcacatttgctcccactatccgttcgtgtg
gtgaaggaaatggacatgaatgaagttaaagctcttgtcagtgccttttatgcagacctt
gtgaaagaggatgaaactttgctttctcttgggagtatgttggctgtcctagataaaata
cttacgaagcaggtgtgcaatggaattgcagaatcacccacagcttctgtttctgttgct
gttgcactaagacattctgttcgttttggatttcaaagagtgctttgcatatttgttgga
gacatggaaatcataccaaacacagaagatggaagaatactcatgatacatatttgtgaa
aaacaacaatctgaaaagaccaactccaaacactatatttcactgaactggaaggagggt
gctgaaggaaatgacttcttttctgctgtatttggattcattcttcctgtagcatatagt
tatcaagctaacttaacagtaatagctgttggaccaaataggagccttggaataaatggg
atttctttactttttggtttactacgaggattagctgagtctcgaattcttgcagtgatt
gagaacacagagatgaatctaatgcaaagtgtagctaaagccttagtgggtgattctaca
cctgacttcggagtctatgcacctcctacccaagaaaaagtacgtaaaataaaaatatta
agagaccagcttcagcaggaatggaagatgcttcagtgttcagtgaagaatgggatttca
ggaaattga

DBGET integrated database retrieval system