KEGG   Apteryx australis mantelli (brown kiwi): 106496528Help
Entry
106496528         CDS       T04298                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106496528 (MAPK6)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106496528 (MAPK6)
Protein kinases [BR:aam01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106496528 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 106496528
NCBI-ProteinID: XP_013812682
LinkDB All DBs
Position
Un
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKLFEILGPSGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAETIQLSLQ
HESTDIDKLNDLNSSVSQLELKGLISKSVSREKQEKGMANLAQLEALYQTSWDSQFVSSG
EECFLIDQFCCEVRKDEQVEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKPGEKEREES
FLSNSGELLFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcacggttttgatctgggctctcggtat
atggacttaaaaccactgggctgtggaggaaatggcttagttttttctgctgttgataat
gactgtgacaaaagagtggctgtcaagaaaattgtccttacagatcctcagagtgttaaa
catgctctacgtgagatcaaaattattagaagacttgaccacgataacattgtcaaacta
tttgaaattcttggtcctagtggaagccagttaacagatgacgtgggctcccttacagaa
ttgaactgtgtttacattgtccaggagtacatggaaacagatctggctaatctgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatattcactctgcaaatgttctgcatagagatctcaaaccagctaatcttttcata
aatactgaagacttggtgctgaagattggtgattttggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggttactaaatggtacagatcaccc
cgtctcttgctttctcctaacaactacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcacatgaacttgaacag
atgcagttgattctagaatcaattcctgttgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaatgatatgactgagccacacaaacctttaactcag
ttgcttccaggcatcagtcctgaagcactggactttttggagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttacatgagcatttattcc
tttccaacggatgagcctatttcaagtcatccttttcacattgaagatgaggttgatgat
attctgctgatggacgaaagtcacagccatatttataattgggaaagataccatgagagt
cagttttcagaccatgactggcctattcataataactatgaagctgatgaagtgcagcgt
gatccaagggctctttctgatgttactgatgaggaagaagtgcaagtagatcctcgcaaa
tatttggatggagatcgtgaaaagtatctggaggatcctgcttttgatacccacttctct
actgagccttgctggcagtattcagatcaccatgaaaacaagtattgcgatctggaatgt
agtcacacttgtaattacaaaatgaggtcatcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctttcaaactggaag
gaacagagcaaagaaaagtctgataagaaaggcaagtctaaatgtgaaaagaatggattg
gtgaaagctcagatagcacttgaggaagcatcacagcagcttgttgaaaaagaaagggag
aagaatcaaggatttgactttgattcgtttatagcagaaaccattcagcttagtttacaa
catgagtctactgatattgataaattaaatgacttgaatagctcagtgtctcaactagag
ttgaaaggattaatatcaaagtcagtgagcagagagaagcaggagaaaggaatggctaat
ttggcacagttagaagctctgtaccaaacttcttgggatagtcagtttgtaagtagtggg
gaagagtgcttcctcatagaccagttttgttgtgaagtaaggaaagatgaacaagttgaa
aaagaaaatacttacaccagttatttggacaaattttttagtaagaaagaagatgccgaa
atgctagaacctgagccagtagaggaggggaagcctggggagaaggagagagaagagagc
tttctcagtaacagtggagaactcctcttcaacaagcagcttgaggctataggtattcct
cagtttcacagccctgtcggttctcccctgaaatcaatacaggccacgttaacgccttct
gctatgaaatcatctccccaaattccccacaaaacatacagcagcattctgaaacatcta
aattaa

DBGET integrated database retrieval system