KEGG   Apteryx australis mantelli (brown kiwi): 106497167Help
Entry
106497167         CDS       T04298                                 

Definition
(RefSeq) trypsin II-P29-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04080  Neuroactive ligand-receptor interaction
aam05164  Influenza A
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106497167
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    106497167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aam01002]
    106497167
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aam04147]
    106497167
Enzymes [BR:aam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106497167
Peptidases [BR:aam01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106497167
Exosome [BR:aam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106497167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 106497167
NCBI-ProteinID: XP_013813435
LinkDB All DBs
Position
Un
AA seq 390 aa AA seqDB search
MKVFLILSCLGAVVAVPGDADDDKIVGGYNCPAHSVPYQVSLNAGYHFCGGSLINNQWVV
SAAHCYKSYIQVRLGEYNIDVQEDSEVVRSSAAIIRHPKYSSRSLDNDIMLIKLASPVAY
SADIQPIALPSTCVKAELGGRGTMKVFLILSCLGAVVAVPGDADDDKIVGGYNCPAHSVP
YQVSLNAGYHFCGGSLINNQWVVSAAHCYKSYIQVRLGEYNIDVQEDSEVVRSSAAIIRH
PKYSSRSLDNDIMLIKLASPVAYSADIQPIALPSTCVKAGTGCLISGWGNTLSSGSSFPE
IVQCLQAPVLSDQECRDAYPGQISSNMMCVGFLEGGKDSCQGDSGGPVVCDGTLQGIVSW
GIGCALKGYPGVYTKVCNYVNWIQETIAAY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttcctgattctctcctgcttgggggcagttgttgctgtcccgggggacgct
gacgacgacaagattgtgggaggctacaactgcccagcacattcagtgccctaccaggtg
tccctgaatgctgggtatcacttctgtggaggttccctcatcaacaaccaatgggtcgtg
tcagctgctcactgctacaagtcctatatacaggtgaggctgggagagtacaacattgat
gtgcaggaagacagtgaagtggtcaggagttctgcagcaatcattcgccatcctaaatac
agttcaagaagccttgataacgacattatgttgatcaagctggcatccccggtggcctac
agcgccgacattcaacccatagctctgcccagcacctgtgtcaaggcggagcttggtggc
agaggcaccatgaaggtcttcctgattctctcctgcttgggggcagttgttgctgtcccg
ggggacgctgacgacgacaagattgtgggaggctacaactgcccagcacattcagtgccc
taccaggtgtccctgaatgctgggtatcacttctgtggaggttccctcatcaacaaccaa
tgggtcgtgtcagctgctcactgctacaagtcctatatacaggtgaggctgggagagtac
aacattgatgtgcaggaagacagtgaagtggtcaggagttctgcagcaatcattcgccat
cctaaatacagttcaagaagccttgataacgacattatgttgatcaagctggcatccccg
gtggcctacagcgccgacattcaacccatagctctgcccagcacctgtgtcaaggcgggc
accgggtgcctgatttcggggtggggaaacacactgagcagcggctctagtttccctgag
attgtccagtgcctgcaagctccagtcttgagtgaccaagagtgccgagacgcttacccg
ggccagatctccagcaacatgatgtgtgtaggattcctggagggtgggaaagactcatgc
cagggtgactcgggcggcccagttgtgtgtgacgggacactccaggggatcgtatcatgg
ggaatcgggtgtgctctgaaaggctaccctggcgtctacaccaaggtctgcaattatgtc
aactggatccaagaaaccattgcagcctactga

DBGET integrated database retrieval system