KEGG   Apteryx mantelli mantelli (brown kiwi): 106498229
Entry
106498229         CDS       T04298                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04068  FoxO signaling pathway
aam04110  Cell cycle
aam04115  p53 signaling pathway
aam04218  Cellular senescence
aam04310  Wnt signaling pathway
aam04340  Hedgehog signaling pathway
aam04371  Apelin signaling pathway
aam04510  Focal adhesion
aam04530  Tight junction
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106498229 (CCND1)
   04340 Hedgehog signaling pathway
    106498229 (CCND1)
   04371 Apelin signaling pathway
    106498229 (CCND1)
   04068 FoxO signaling pathway
    106498229 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106498229 (CCND1)
   04115 p53 signaling pathway
    106498229 (CCND1)
   04218 Cellular senescence
    106498229 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106498229 (CCND1)
   04530 Tight junction
    106498229 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106498229
NCBI-ProteinID: XP_013814834
LinkDB
Position
Un
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKMV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGDTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggagcatcagctgctgtgctgcgaggtggagaccatccggcgggcctacctggatgcc
aacctcctcaatgacagggtgctgcagaccatgctcaaggccgaggagacctgctcgccc
tccgtgtcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatggtt
gccacttggatgctggaggtttgtgaggagcagaagtgcgaagaggaagtttttcccttg
gctatgaattatttggacagatttttgtcgcttgaacccctcaagaaaagccgactgcaa
ttgctcggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttataccgataactccattagacccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccatgatttc
attgaacatttcctaactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
cacgctcagacttttgtggctctctgcgctacagatgttaaatttatttcaaacccgcct
tccatgatcgcagctggcagtgtagtagctgctgtgcaaggcctgcatctgggggacact
aacaccttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgac
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgc
caggcacagcaacacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system