KEGG   Apteryx mantelli mantelli (brown kiwi): 106498480
Entry
106498480         CDS       T04298                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam04010  MAPK signaling pathway
aam04060  Cytokine-cytokine receptor interaction
aam04068  FoxO signaling pathway
aam04144  Endocytosis
aam04218  Cellular senescence
aam04350  TGF-beta signaling pathway
aam04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106498480
   04350 TGF-beta signaling pathway
    106498480
   04068 FoxO signaling pathway
    106498480
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106498480
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106498480
  09143 Cell growth and death
   04218 Cellular senescence
    106498480
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106498480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106498480
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106498480
Protein kinases [BR:aam01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106498480
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TNFR_16_TM
Other DBs
NCBI-GeneID: 106498480
NCBI-ProteinID: XP_013815182
LinkDB
Position
Un
AA seq 586 aa
MGHGKRAALLSLLLLSCAWCAGARRSLKTNLCKWCDATAPACEERVCYSNCNLNSYCESP
YEICVAIWRQDNESIRISTLCHNPHHPIENLMVPNYNTSRCIMTHQPSEDGIIYICGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKQRKRAK
AWSQKHAQHPTLPDRGKAAERDEKLSVMTDDNQATVSSTCANSINHNTELLPIELDEMVG
KGQFAEVWRAKLNHTSSGQYETVAVKIFPCEEYSSWKNESQIFTDASLKHDGVLQFLTAE
DRGSGPRKEYWLITAYHSRGNLKDYLSRHVLSWMDLQKMAGSLVNGVAHLHSDYTACGRP
KIPIAHRDIKSTNILVKNEQECVLCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVLE
SRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGGNAFSVRHHHGVLGPRPRGSPHSPLR
GRALQPDGADGLRRHPQQQHGQRRRQDRLSWRGAPGQRREQKRAVTRQAKSLLGRNEGIS
DKCLARGKKALAPFFKAELRSDTQLIYKTCFIPQIQCRELWNQYFG
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgggccacgggaagagagcggctctgctttccctgctgctgctgtcctgcgcctggtgc
gccggggcgcgccgcagcctgaagaccaacctgtgcaaatggtgcgacgcgacggcgccg
gcctgcgaggagcgggtctgctacagcaactgcaacctcaactcctactgcgagagcccc
tacgagatctgcgtggccatctggagacaagacaacgagagcatcaggatcagcacgctc
tgccacaacccccaccacccgatagaaaacctcatggtcccaaactacaacacctcacgc
tgcatcatgacccatcagcccagcgaggatgggatcatctacatctgtggctgcgtggat
gagcaggaatgcaatgacaaacttatcttcgaaaaccacaccaatggatactccatgctg
cagagcaaagaggtcatcccggtggctgccatcagcctcctgcctccgctgctcgtggcc
gtgatgatcacggtgatattttacctctgccgcacgcagaagcagaggaagagagccaag
gcgtggagccagaagcacgcacagcacccgactttgccagaccgagggaaggccgccgag
cgcgatgagaagttgtcggtgatgacggacgacaatcaggccaccgtaagctctacctgc
gccaacagcatcaaccacaacaccgagctgctccccatcgaactggacgaaatggtgggg
aaaggccagtttgccgaggtctggagggccaagttaaaccacaccagctcagggcaatac
gagacggtggctgtgaagatcttcccctgcgaggaatattcctcctggaaaaatgagagc
cagatcttcacagacgccagcctcaagcacgacggcgtcctgcagttcctcacagccgag
gacaggggatcggggccccggaaggagtactggctcatcactgcctaccacagccggggc
aacctcaaggactacctgtccaggcacgtcctgagctggatggacttacaaaaaatggca
gggtcccttgtcaacggggtggctcacctccacagcgactacactgcctgcggcaggcca
aaaatccccatcgcccaccgggatatcaagagtaccaacatcctggttaagaacgagcag
gagtgcgtgctctgcgacttcggcattgcgatacgcctcgacccttccctgacggttgat
gactttgcaaatagcgggcaggtgggcaccgccaggtacatggctccggaagttctagag
tccagagtgaatctggaagatctggagtctttcaagcaaatggacgtctactccatggcc
ctggttttatgggaaatggcctccagatgtgaagtggtaggagggaatgcgttttctgtg
cgacaccatcacggagtgctgggaccacgaccccgaggctcgcctcacagcccactgcgt
ggccgagcgcttcaacctgatggcgcagatggactgcgacgacatcctcaacaacaacac
ggacaacgacgccggcaagaccgcctgtcctggcggggagcacccgggcagcgacgggag
cagaaacgggcagtgacgcggcaggcaaaaagcctcctcggaagaaatgaggggataagc
gacaagtgtttagctcgtggtaaaaaagccctcgctccatttttcaaagcagaactaaga
tctgacacacaacttatttataagacctgtttcatcccacagatacagtgcagagaactg
tggaatcaatactttggctaa

DBGET integrated database retrieval system