KEGG   Apteryx australis mantelli (brown kiwi): 106498537Help
Entry
106498537         CDS       T04298                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00480  Glutathione metabolism
aam00980  Metabolism of xenobiotics by cytochrome P450
aam00982  Drug metabolism - cytochrome P450
aam00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106498537 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106498537 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    106498537 (GSTO1)
   00983 Drug metabolism - other enzymes
    106498537 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aam02000]
    106498537 (GSTO1)
Enzymes [BR:aam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106498537 (GSTO1)
Transporters [BR:aam02000]
 Other Transporters
  Pores ion channels [TC:1]
   106498537 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_C_3 GST_N_2 GST_C GST_N GST_C_5 Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 106498537
NCBI-ProteinID: XP_013815247
LinkDB All DBs
Position
Un
AA seq 214 aa AA seqDB search
MIWSGTVAELILLCLISLFSHEVININLKNKPDWFFEKNPFGLVPVLETSKGQLIYESPI
TCEYLDEAFPGKKLLPLDPYERAFQKMLLEYFSKLTPIVFQYYVAVRDGQDTSALKAEFV
EKLGKLEEMLSKCNTVFFGGDSISMFDYMIWPWFERLEAVQLQDSLSHTPKLQRWMEAMK
EDPAVKATMTDPQTYKGYLQLYLKNSPEACDYGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatatggagtggtactgtagcagaactgatccttttgtgtcttatttcactcttcagc
catgaagtaatcaacatcaatctgaagaacaaacctgactggttctttgagaagaacccc
tttggactggttcctgttctggagaccagcaagggccagctgatctatgagtctccaatc
acttgtgagtatttggatgaagcatttccggggaagaagctgctgcctttggacccgtat
gagcgagcctttcagaagatgctcctggaatacttctcaaagctgacacctatagtcttc
cagtattatgttgcagtcagagatggacaggacacctcggcactgaaagcagagtttgtt
gaaaagcttggcaaacttgaagagatgctgtccaaatgcaatactgtgttttttggcggg
gactccatctccatgtttgactacatgatctggccctggtttgaacgcctggaggcagta
cagctgcaggactctctgagtcacaccccaaagcttcaacgctggatggaggccatgaag
gaggaccctgctgtcaaggctacaatgactgatccacagacctacaaaggctatctccag
ctctatctgaagaacagccctgaggcatgtgattatgggctttga

DBGET integrated database retrieval system