KEGG   Apteryx mantelli mantelli (brown kiwi): 106498669
Entry
106498669         CDS       T04298                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Pathway
aam00220  Arginine biosynthesis
aam00330  Arginine and proline metabolism
aam01100  Metabolic pathways
aam04020  Calcium signaling pathway
aam04146  Peroxisome
aam04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106498669 (NOS2)
   00330 Arginine and proline metabolism
    106498669 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106498669 (NOS2)
   04020 Calcium signaling pathway
    106498669 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106498669 (NOS2)
Enzymes [BR:aam01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106498669 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 DUF1400
Other DBs
NCBI-GeneID: 106498669
NCBI-ProteinID: XP_013815385
LinkDB
Position
Un
AA seq 934 aa
MFEHICSHVQYATNHGNIRSAITVFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSIIGDPA
SVEFTQLCIELGWKPKYGRFDVVPLILQANGQDPEIFEFPPEIILEVPMEHPKYEWFKEL
DLKWYALPAVANMLLEVGGLEFTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLE
TNKLSSLWKDRAVVEINVAVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWV
WLVPPISGSITPVFHQEMLNYVLTPFFYYQVDAWKTHFWHDETRRPKKKEIKLSILAKAV
LFASSLMRKTMAARSKVTVIYATETGKSETLASSLCSLFSCAFNTKILCMDEYKICDLEK
ETLLLVVTSTFGNGDSPNNGKTLKNSLLTLKLLRRKIRYAVFGLGSTMYPEFCAFAHAID
RKLAQLGASQLTPVGEGDELNGQEEAFRSWAVNAFKTACDIFNIRGKNSIQLPGIYTSSE
SWDPENYRIVHDSQTMDLTKALADIHAKDVIPMKLKFRQNLQSLKSSRVTILVKLSCETN
QEVHYLPGEHIGIFPGNQPELVCGLIAHVKDAPPADQTIRLETCTNGGYWASDKKIPACT
LPQALSYFLDITTPPSQQLLKKLSQLVTEEGEKERLEVLCHNTEEYNKWKFYNNPNILEV
LEEFPSAEVSTSFLLTQLPLLKPRYYSVSSCCDMTPREIHLTVAVVNYKTRGGQGPLHHG
VCSTWLNTIAVNEIVPCFVRSTNGFQLPRESTKPCILVGPGTGIAPFRSFWQQRLYDLEK
KGIKGGDMTLLFGCRQPDMDHIYKEEMEEMKRKGVLKEVYTAYSRQPGQPKVYVQDILQS
KLEAKVCNLLHKEEGHLYVCGDVCMARDVAQTLKGMLASKLNLTEQQAEEYIFQLKSQKR
YHEDIFGAVFPHEVKRDVRTLQSTSPRANQQTMF
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgtttgagcatatctgtagtcatgttcagtatgcaacaaaccatggaaatatcagatca
gccatcactgtcttcccccagaggactgatgggaaacatgatttccgtgtttggaacagc
cagctcattcgatatgctgggtatcaaatgccagatgggtctatcataggagaccctgct
agtgtggagttcacgcagttgtgcatcgagcttgggtggaagccgaaatatggccgcttt
gatgtagttccactcattctccaagcaaacggccaagacccagaaatatttgaattcccg
ccagaaattatccttgaagtgccaatggagcatccaaagtatgaatggtttaaggagttg
gatctgaagtggtacgcactgcctgctgttgccaacatgcttcttgaggtgggaggcctg
gagtttacagcgtgtcctttcaatggctggtacatggggacagagataggagtgcgagac
ttctgtgatgtacagcggtacaatatcctgaaggaggtaggaagaagaatgggactggaa
acaaacaaactttcatcactgtggaaagaccgagctgttgtagagattaatgtggccgtg
cttcatagctttcaaaaacaaaatgttactatcatggatcaccactctgctgctgaatcg
ttcatgaaatacatgcagaatgagtaccgcgtgcgaggaggctgcccagctgactgggtg
tggcttgtgcctcctatatcagggagcatcactccagtgttccaccaggagatgctgaac
tatgtcctcactcccttcttttattaccaggtggatgcttggaaaacacatttctggcat
gatgagacccggaggccaaagaaaaaagaaataaagcttagcatcttggcaaaggctgta
ctctttgcatcttcactcatgcgaaaaacaatggcagccagatccaaggtcaccgtgatc
tatgcaacagagactgggaaatctgaaacattagccagcagtctgtgcagcttgttcagc
tgtgccttcaacactaagattctgtgcatggatgagtacaaaatctgtgacctggaaaaa
gaaacactccttttagtggttaccagcacttttggaaatggagattctccaaataatgga
aagacattgaagaactccttgttgaccctgaaattgctgagaagaaaaattagatatgcc
gtgtttggtttggggtccaccatgtatccagagttctgtgcctttgctcatgccattgac
cgaaaactggcccagctaggggcttctcagctcactccagtaggtgaaggagatgaactc
aatgggcaggaagaagcttttcgcagctgggcagtcaatgcattcaagactgcctgtgac
attttcaacatccgtgggaaaaacagtattcagttgcctgggatatatacttcatctgaa
agctgggatcctgagaattacaggatagtacatgactctcaaaccatggacttgactaaa
gcacttgcagacattcatgcaaaggatgtaattcccatgaagctgaaattcaggcagaat
ctgcagagtttaaaatccagtcgtgttaccatcctggttaagctttcctgtgagactaat
caggaagtgcactacctgcctggagaacatatcgggattttcccaggcaaccagccagaa
ttagtctgtggcctcattgcacatgtcaaggatgccccaccagctgatcagactatcaga
cttgaaacatgcactaatggtggctactgggcaagcgacaaaaaaattccagcctgcaca
ctcccccaagctttgtcatacttccttgatatcactactccaccctctcaacaactgcta
aaaaaactctcccagctggtaacagaggaaggagaaaaagagagactggaagtcttatgt
cataacacagaagaatacaataaatggaagttttacaacaaccctaacatcctggaggtc
ctggaggagtttccttctgcagaggtctcaacatctttcttactgactcagctgccgctt
ctgaaacccaggtactattctgtcagttcctgctgtgacatgacacccagagagattcat
ctgacggttgcagtggtcaactacaagacaagaggtgggcaaggacctttgcaccatgga
gtttgcagtacatggctgaatacaatagctgtcaatgaaatagtcccatgctttgtacgc
agtactaatggattccagctcccaagggagtcaaccaagccatgcattctagttggtcca
ggaacaggaattgctccgttcagaagtttctggcagcagcgtctctatgacttggaaaag
aaaggaatcaaaggtggtgacatgacattattgtttggctgccggcagccagacatggat
cacatctacaaagaagaaatggaggaaatgaagaggaaaggagttctgaaagaggtctat
acagcttactccagacaacctggccaacctaaggtctatgttcaagacattcttcaaagc
aagttggaagccaaagtgtgcaacctcttgcataaggaagaagggcatctgtatgtctgc
ggagatgtatgcatggccagggatgttgctcagactttgaaggggatgcttgcaagtaaa
ctgaaccttactgagcagcaggcagaggaatatatcttccagctaaagagccaaaagcgg
taccatgaagatatatttggggctgtgtttccacatgaagtcaaaagagatgtaagaacc
ttgcaatccaccagtcctcgagcaaatcaacaaacaatgttttag

DBGET integrated database retrieval system