KEGG   Apteryx australis mantelli (brown kiwi): 106499857Help
Entry
106499857         CDS       T04298                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam00020  Citrate cycle (TCA cycle)
aam00310  Lysine degradation
aam00380  Tryptophan metabolism
aam01100  Metabolic pathways
aam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106499857 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    106499857 (OGDHL)
   00380 Tryptophan metabolism
    106499857 (OGDHL)
Enzymes [BR:aam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     106499857 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 106499857
NCBI-ProteinID: XP_013816934
LinkDB All DBs
Position
Un
AA seq 1014 aa AA seqDB search
MSHLKLFAATLKWHGIKLLEKHDIARKVFFHGQRYVSSGISEPFLSGSNSSYVEEMYYAW
LENPKSVHKSWDLFFRNANAGQAYDPHLPDQLERKASFLQSHGLAQTPGKAEKLVEDHLA
VQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGFYGLHESDLDKVFQLP
TTTFIGGSETSLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMKFTNE
EKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGM
PHRGRLNVLANVIRKELEQIFCQFDPKLEATDEGSGDVKYHLGMYHERINRATNKKITLS
LMANPSHLEAVDPVVQGKTKAEQFYRGDMAGKKVMSILLHGDAAFAGQGVVYETFHLSDL
PSYTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCSV
AAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGT
VTLQEFEEEIAKYDRICEEAYTRSKDNKILHIKHWLDSPWPGFFNVDGEPKSMSCPPTGI
SEDLLTHIGNVASSVPVKDFKIHAGLSRILRARLEMTKNRVVDWALAEYMAFGSFLKEGI
HVRLSGQDVERGTFSHRHHVLHDQEVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGVLGFE
LGFAMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPE
HSSARPERFLQMSNDDSDAYPEFTEQFEVSQLYECNWIVVNCSTPANYFHVLRRQILLPF
RKPLIILTPKSLLRHPEAKSSFDEMVSGTTFQRVIPENGLAAHTPHEVRRVIFCTGKVYY
DLVKERKSQDLEKQVAITRLEQISPFPFDLLKEELEKYPGADLVWCQEEHKNSGYYDYVK
PRFRTIVNHTRPIWYVGREPAAAAATGNKNTHLVSLRRFLDTAFNLEAFEGKTF
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctgaagttgtttgcagctacgctgaagtggcatggcattaaacttctggaa
aagcatgatatagccagaaaggtatttttccatggccaacgatatgtttcatcaggaatc
tcagaaccgttcctgagtgggagtaattccagttatgtggaggaaatgtattatgcatgg
cttgaaaaccctaaaagtgtgcataagtcctgggatttgtttttccgaaatgctaatgct
ggccaagcgtatgacccacacttaccagatcagttagaaagaaaggcatcatttcttcag
agccatggcctagcccagacaccgggtaaagctgagaaacttgttgaagatcaccttgct
gtgcagtctttgataagagcataccaaattcgtggccatcatgtggctcagttagacccc
cttggaattttggatgcagacttggattcgtttgttccatctgacttaatcactacaatt
gataaacttgggttttatggtttgcatgaatcagatttggacaaagtctttcagctgcct
acaaccaccttcataggaggaagtgagaccagtctttctttacgagagatcatcagacgg
ctggagaatacctactgccaacacattggcctggaatttatgttcatcaatgatgtggag
cagtgccagtggatccgacagaagtttgaaacaccgggtgttatgaagtttactaatgag
gagaaaaggactttgttggcaaggctggtgcgctcaatgagatttgaagactttcttgct
cgcaagtggtcttcagaaaagcgatttggtttggaaggatgtgaagtaatgattcctgca
cttaagaccatcatcgataagtccagtgaaatgggaattgaatatgttataatggggatg
cctcatagaggtagactgaatgtgttggctaatgtcatccgaaaagagctggagcagatc
ttctgtcagtttgatcccaaacttgaagcaactgatgagggatctggggatgtaaaatat
catctgggaatgtaccatgagaggatcaaccgagcaacaaataagaaaatcactctgtcc
ctgatggctaacccttctcatttggaagcagtggatcctgttgtgcaggggaagactaaa
gccgaacagttttatcgaggggatatggcaggaaaaaaggttatgtccatattattacat
ggggatgctgcctttgcagggcagggagtggtttatgagacgtttcatcttagtgacctc
ccatcttacaccacaaatggcactattcatgttgtggtcaataaccagattggcttcacc
acagacccccgaatggcccgttcatctccataccctactgatgttgctcgtgtggtaaat
gctcccatttttcatgtgaatgctgatgaccctgaagcagtgatgtatgtgtgcagtgta
gctgcagaatggcggaacacattcaataaagatgtcgttgttgacttggtttgttaccgc
aggagagggcacaatgaaatggatgaaccaatgttcacccagcctctaatgtacaagcag
attcataagcaggtgccagtgctgaagaagtatgctgacaaactgattgcagatgggact
gtaacactacaggagtttgaggaagaaattgcaaagtatgacagaatatgtgaagaagca
tatactagatccaaggataataagattctacatattaagcactggcttgattcaccttgg
cctggattctttaatgtggatggagaacccaagagcatgtcatgtcccccaactggcatt
tcagaagacctactgactcacattggcaatgtagctagttcggtgccagtgaaagacttc
aaaatacatgcaggactctctcggattttgagagcccgcctggaaatgaccaagaacagg
gttgttgactgggccttagcagaatacatggcttttggctcttttctgaaagaagggatc
catgtccgactaagtggacaggatgtggaaaggggtacttttagccatcgccatcacgtg
cttcacgatcaagaagttgacaagaggacgtgcgttcccatgaatcacctctgggagcag
caggccccctacactgtgtgcaacagctccctttcggaatatggcgtcttaggttttgaa
cttggctttgctatggcaagtcccaacgccctggtgtgctgggaggcccagtttggcgac
tttcacaacacagcccagtgtataatagaccagttcatcagctcaggccaggctaagtgg
gttcgccacaatgggattgttctgctcttgccacatgggatggaaggaatgggtccagag
cattcatcggcgaggcctgagaggtttctgcagatgagcaatgatgattctgatgcttat
ccagagttcactgaacagtttgaagtttcccagctgtatgaatgcaactggattgtggtg
aattgttcaactccagccaattactttcacgtcctcagaagacagatcttgctgccattc
agaaaaccgctgattatcttgacgcccaagtcactgttgaggcatccagaagctaaatcc
agttttgatgaaatggtatctggtaccactttccaacgtgtgattcctgagaatgggctg
gcagctcatacgccgcatgaggtcaggcgagtgattttctgtacggggaaagtgtactac
gatcttgtgaaagaaagaaagagtcaagacttggagaaacaagtggctataactagattg
gaacagatctcaccattcccctttgacctgctgaaagaagagcttgagaagtatccaggg
gctgatctagtttggtgtcaggaggagcacaagaacagtggatattatgattatgtcaaa
cctcgtttccgcactattgtgaaccacactcgacctatatggtatgttggccgagagcct
gctgctgctgccgccacaggcaacaagaacactcatctggtgtcgctcagaagattcttg
gatacagctttcaacctggaggcctttgagggaaagacattctaa

DBGET integrated database retrieval system