KEGG   Anoxybacillus amylolyticus: GFC30_120Help
Entry
GFC30_120         CDS       T04397                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
aamy  Anoxybacillus amylolyticus
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aamy03110]
    GFC30_120 (hslO)
Chaperones and folding catalysts [BR:aamy03110]
 Heat shock proteins
  HSP33
   GFC30_120 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF2587
Motif
Other DBs
NCBI-ProteinID: ANB59522
UniProt: A0A160F1L8
LinkDB All DBs
Position
complement(107668..108558)
Genome map
AA seq 296 aa AA seqDB search
MSDYLVKALAYDGQVRAYAVRTTETVREAQRRHQTWPTASAALGRAMTAGVMMGAMLKGD
SKLTIKIEGGGPIGAILVDSNANGEVRGYVTNPHVHFELNQHGKLDVARAVGTSGMLTVV
KDLGLRDFFTGQVPLVSGELGEDFTYYFASSEQVPSSVGVGVLVNPDHTILAAGGFILQL
MPDVKNATIDEIEQRLKTIPPVSKMVERGLTPEEILEELLGKGNVKVLETVPVAFVCRCS
RERIVDALISLGPKEIQDIIDEEGYAEASCHFCNETYYFTREELEKLKQMAELPAE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactacttagtaaaggcattagcatatgacggccaagtaagagcgtatgcggtg
cgaacgactgaaaccgttcgtgaggcacagcgtcgccatcaaacgtggccaaccgcttct
gcagcgcttgggcgcgcgatgacagcaggtgtcatgatgggagcaatgttaaaaggcgac
agcaaactaacgattaaaattgaaggtggcggtcccatcggtgctattctcgtggatagc
aacgccaatggggaagtaaggggatatgtaacgaatccccatgttcacttcgaattaaac
caacatggtaaactagacgttgctcgagcggtcgggacaagtggcatgttaacggttgta
aaagatttaggcttgcgcgattttttcaccgggcaagttcctctcgtttcgggtgagctt
ggggaggattttacgtattatttcgcgtcctctgaacaagtcccttcttctgtcggggta
ggagtgttagtgaatcccgatcacacgattctggctgctggtggattcatccttcagtta
atgcctgatgtcaaaaatgcaacgattgacgaaatagaacagcggctaaaaacgattcca
ccggtgtctaaaatggtggaaagaggactaacgccggaagaaattttagaagagttgctt
ggaaaagggaatgtcaaagtgctcgaaacagtccctgtcgcttttgtatgccgttgctcg
cgagagcggattgttgatgcgcttatcagtttaggaccgaaagaaattcaagatattatc
gatgaagaaggatatgcggaagcatcgtgccatttttgtaatgaaacatattactttaca
cgagaagaattggaaaaactaaaacaaatggcagaattgccagcagaataa

DBGET integrated database retrieval system