KEGG   Anoxybacillus amylolyticus: GFC30_2654Help
Entry
GFC30_2654        CDS       T04397                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aamy  Anoxybacillus amylolyticus
Brite
Enzymes [BR:aamy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GFC30_2654 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANB61281
UniProt: A0A160F593
LinkDB All DBs
Position
complement(2537108..2537716)
Genome map
AA seq 202 aa AA seqDB search
MPFELPPLPYAYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHAELQSKTLEELLSN
LDALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFAAFKEEFA
KAATTRFGSGWAWLVVNNGELEVTSTPNQDTPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YISAFWNVVNWDEVEKRYQEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgaattaccaccattaccttatgcgtatgatgcgcttgagccgcacattgac
aaagaaacgatgaacattcaccacactaaacaccataatacgtatgtgaccaacttaaat
gctgcattggaaggacatgcggaattgcaaagcaaaacgttagaagagttgcttagcaac
ttagacgcgctcccagaaagcattcgcacagcggttcgcaacaacggaggcggacacgca
aaccattcgcttttctggacgattctttcaccaaatggcggcggagagccaacaggcgaa
ttagccgaagcaatcaacaaaaaattcggcagctttgctgcgtttaaagaagagtttgca
aaagcagcaacgactcgtttcggttctggttgggcttggcttgtggtgaacaacggtgaa
ctagaagtgacaagcactccaaaccaagacacgccaatcatggaaggaaaaacaccaatt
cttggcttagacgtttgggagcatgcgtactacttaaaatatcaaaaccgtcgcccagaa
tatatttctgcgttctggaacgttgtgaactgggacgaagtagaaaaacgttaccaagaa
gcaaaataa

DBGET integrated database retrieval system