KEGG   Anoxybacillus amylolyticus: GFC30_3047Help
Entry
GFC30_3047        CDS       T04397                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00020  Citrate cycle (TCA cycle)
aamy00480  Glutathione metabolism
aamy01100  Metabolic pathways
aamy01110  Biosynthesis of secondary metabolites
aamy01120  Microbial metabolism in diverse environments
aamy01130  Biosynthesis of antibiotics
aamy01200  Carbon metabolism
aamy01210  2-Oxocarboxylic acid metabolism
aamy01230  Biosynthesis of amino acids
Module
aamy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aamy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFC30_3047 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GFC30_3047 (icd)
Enzymes [BR:aamy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GFC30_3047 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANB62093
UniProt: A0A160F7P6
LinkDB All DBs
Position
pDSM15939_1:complement(75833..77101)
Genome map
AA seq 422 aa AA seqDB search
MQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKEV
LAGEKAYKLTGEWLPQETLDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLRP
VRYFNGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIRF
PETSGIGIKPISEEGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELAE
QEFGDKVFTWAEYDRIVETEGKDAANKAQAEAEAAGKIIIKDAIADIFLQQILTRPREFD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPSS
VILSGVMMFEHLGWNEAAKLIIDSMEKTIASKVVTYDFARLMEGATEVKCSEFADALIRN
ME
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaggtgaaaaaattacggttacaaacggtgtgttaaacgtaccaaacaatccgatt
attccgttcattgaaggggacggaacgggtcctgacatttgggcagctgcttctcgcgta
ttagaggcagcagtagaaaaagcatacaaaggcgaaaagaaaattgtctggaaagaagtg
ctcgctggcgaaaaagcgtacaaattgacaggagaatggttgccgcaagaaacgcttgat
gtcattcgagaatacataatcgcgattaaaggtccacttacgacgccagtaggtggcggg
attcgttcgttaaatgttgcgcttcgtcaagagctagatttatttgtctgcttgcgtcca
gttcgttattttaacggcgtgccttctccagttaagcgtccagaagatacggacatggtc
attttccgtgaaaacacggaagacatttatgcgggtattgaatatgcaaaaggaacgcca
gaagtgaaaaaagtaattgacttcttgcaaaacgaaatgggcgttcgcaaaatccgcttc
ccagaaacgtctggtattggcattaaaccgatttccgaagaaggaacgaaacgccttgtc
cgcgcagcaattaactacgcaattgagcatggacgcaaatctgtaacgctcgtgcataaa
ggaaatattatgaaatttacagaaggggcgttcaaaaactggggctatgaattagcagag
caagaatttggcgataaagtgttcacttgggcagaatacgaccgcatcgtggaaacagaa
ggaaaagatgcggcaaacaaagcgcaagcggaagcagaagcagctggaaaaatcattatt
aaagatgcgattgccgatattttcttgcaacaaattttaactcgtccgcgcgagtttgac
gttgttgcaacgatgaacttgaacggcgactacatttctgatgcgctcgctgcacaagta
ggcggcatcggtattgctcctggggccaacattaactacgaaacaggacatgcgattttt
gaagcaacacatggtacagcgccgaaatacgcaggattagacaaagtgaatccatcgtcc
gtcattttatcaggcgtcatgatgtttgaacatcttggctggaacgaagcagcgaaatta
attattgattcgatggaaaaaacgatcgcgtcgaaagtggttacgtacgactttgctcgc
ctcatggaaggtgcgactgaggtgaaatgttcagagtttgcggatgcgttaattcgcaat
atggaataa

DBGET integrated database retrieval system