KEGG   Anoxybacillus amylolyticus: GFC30_3326Help
Entry
GFC30_3326        CDS       T04397                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00473  D-Alanine metabolism
aamy01100  Metabolic pathways
aamy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GFC30_3326 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GFC30_3326 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aamy01011]
    GFC30_3326 (alr)
Enzymes [BR:aamy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GFC30_3326 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:aamy01011]
 Precursor biosynthesis
  Racemase
   GFC30_3326 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mitovir_RNA_pol
Motif
Other DBs
NCBI-ProteinID: ANB62370
UniProt: A0A167TU85
LinkDB All DBs
Position
pDSM15939_2:58518..59675
Genome map
AA seq 385 aa AA seqDB search
MFHRDTWAEVDLDAIFHNVASLRSFLPKETAIMAVVKANAYGHGDAQVAKTALEAGASHL
AVAFLDEALALRQKGMHAPILVLGATRPEDVDLAAEKRIALTVFQQEWLEEAKQHHQSGL
PVLFHLKMDTGMGRLGVKEEEETKRIVAMIDAYPHFLLEGVYTHFATADEINTDYFSFQY
ETFLRMLEWLPYRPKWVHCGNSATSLRFPTKVFNIVRFGIAMYGLSPSLAIKPYLPFTLK
EAFSLHSRVVHVKRLLPGEKVSYGATYTAEQEEWVGTVPIGYADGWIRKLQNFHVLVNGE
KVPIIGRICMDQLMIRLPSYVPIGTKVTLIGQQADEKITMDEVAQYLDTINYEIPCTISY
RVPRIFLRNKSIMEVRNAVLDGNNV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaccgagatacttgggcagaagtggatctcgatgcgatttttcataacgttgct
tctttgcgatcgtttttaccgaaggaaacggctattatggcagtcgtaaaagcgaatgcg
tatggtcatggcgatgcgcaagtcgccaaaacagctttagaggctggggcgtcgcatttg
gcagttgcctttttagacgaggcacttgcgttgcggcaaaaaggcatgcatgcgccgatt
cttgtcttaggggcaactcggccagaggacgttgatttagctgctgaaaaacgaattgcg
ctcactgtctttcaacaagaatggttagaggaagcaaagcaacaccatcaaagtggctta
ccggtgttgtttcatttgaaaatggatacagggatgggaaggttaggagtaaaagaggaa
gaagaaacgaagcgtattgtggcgatgattgacgcctacccgcattttttgcttgaaggc
gtgtacacacactttgccacagcagatgaaatcaatacggattatttttcttttcaatac
gaaacctttctgcgcatgctcgaatggctgccgtaccgaccgaaatgggttcactgcggc
aatagtgcaacgagtctgcgatttccgactaaagtgttcaatatcgttcgctttgggatt
gcgatgtacggactatctccgtcacttgccatcaaaccgtatttaccatttaccctaaag
gaagcgttttcgcttcatagccgcgtggttcatgtaaaacgtctattgccaggagaaaaa
gtaagctacggtgccacatatacagcagaacaagaagaatgggtagggacggttccgatc
ggttatgcggacgggtggattcggaaacttcagaactttcatgtattagtaaacggggaa
aaggtaccgattatcgggcgaatttgcatggatcaactgatgattcgactgccgtcatac
gtaccaataggaacaaaagtcacccttatcgggcaacaagcggatgaaaaaattacgatg
gatgaagtggcgcaatatttagacactatcaactacgaaatcccttgtacgataagttac
cgcgtgcctcgtatttttttgcgaaacaagagtataatggaagtgagaaatgctgtttta
gatggcaataatgtataa

DBGET integrated database retrieval system