KEGG   Anoxybacillus amylolyticus: GFC30_347Help
Entry
GFC30_347         CDS       T04397                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00240  Pyrimidine metabolism
aamy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    GFC30_347
Enzymes [BR:aamy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GFC30_347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 IMPDH AAA_30 AAA_19 UvrD-helicase
Motif
Other DBs
NCBI-ProteinID: ANB61398
UniProt: A0A160F4P9
LinkDB All DBs
Position
339860..340480
Genome map
AA seq 206 aa AA seqDB search
MYVMTQSGWLEVICGSMFSGKSEELIRRVRRATFAKQEVKVFKPAIDNRYSEEAVVSHNG
TSIIAIPVHSAKEIFTYISEQTDVIAIDEVQFFDEQIVDVVQTLADRGYRVIVAGLDQDF
RGEPFGPVPTLMAIAESVTKLQAVCTVCGSPASRTQRLINGQPASYHDPIILVGASESYE
PRCRHHHEVPDKPTEHYLQKNGQTTC
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgatgacacaatcaggttggctagaagtgatttgcggaagcatgttttccggc
aaatcggaagaactcattcgccgtgtgcgccgtgctacgtttgcaaagcaagaggtgaaa
gtatttaaaccggcaatcgataaccggtatagcgaggaagcggtcgtttcccataacggg
acgtctattattgccattccggtgcattcggcgaaagaaatttttacgtacatatcggaa
caaaccgatgttattgcgatcgacgaagtccaattctttgatgaacaaattgttgatgtc
gtacaaacgttagctgatcgcggctatcgcgtcattgtggccggactcgaccaagatttt
cgcggggagccgttcggaccggtgccaacgttaatggcgattgccgaatcggtgacgaaa
ttgcaagcggtgtgcacggtgtgcggttcgccggcaagccgcacgcaacggttaattaac
ggccagccagcttcttatcatgatccgattattttagttggcgcaagtgaatcgtatgaa
ccgcgttgccgccatcaccacgaagtgccagataaaccaaccgaacactaccttcagaaa
aacggacaaacgacttgctaa

DBGET integrated database retrieval system