KEGG   Anoxybacillus amylolyticus: GFC30_427Help
Entry
GFC30_427         CDS       T04397                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00010  Glycolysis / Gluconeogenesis
aamy00620  Pyruvate metabolism
aamy01100  Metabolic pathways
aamy01110  Biosynthesis of secondary metabolites
aamy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFC30_427
   00620 Pyruvate metabolism
    GFC30_427
Enzymes [BR:aamy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GFC30_427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ANB61237
UniProt: A0A160F495
LinkDB All DBs
Position
complement(415129..416649)
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPSSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGLPYCEVPRSKAADIEL
ALDAAHEAKEAWGRTSVAERARILNKIADRMEENLELLAVVETWENGKPIRETLAADIPL
AIDHFRYFAGCIRAQEGSLAELDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPKGVVNVVNGFGLEAGKPLASNPRIAKVAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFPDVAEKDDEFFDKALEGFTMFALNQGEV
CTCPSRALIHESIYDVFMERALERVQQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNFLEGELSGGYYVQPTVFKGHNKMRIFQEEIFGPVVSVTTFKDEDEAL
AIANETLYGLGAGVWSRNINTAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKMSGIGRET
HKMMLEHYQQTKNLLVSYSPKKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgcccaacctggacaacctagttctctcatcacgttcaaaaaacgctatgaa
aactttatcggcggaaaatgggtgccgccagtcgacggcgaatatttcgaaaacatttcg
ccagtcactgggcttccatactgcgaagtgccgcgttcaaaagccgcagacattgaactg
gcgctcgatgccgcgcacgaagcaaaagaagcatgggggcgcacatcggtcgctgaacgg
gcgcgcattttaaacaaaattgctgaccgcatggaagaaaacctcgaactgcttgccgtc
gtcgaaacatgggaaaacggcaaaccaattcgcgaaacgcttgcagccgacatcccgctt
gcgattgaccacttccgctacttcgctggctgcattcgcgcacaagaaggctcgttagcc
gaactcgatcatgacaccgtcgcttaccacttcaaagaaccgctcggagttgttggacag
attattccatggaacttcccgattttaatggccgcatggaaactcgcaccggcgttggca
gctggaaactgcgttgtcctaaaacctgcagaacaaacaccaacatcgatcctcgtacta
atcgaactcatcgaagacttattgccaaaaggggttgtcaacgtcgtcaacggctttggc
ttagaagctggaaaaccgctcgcgtcgaacccgcgcatcgccaaagtggcgtttactggc
gaaacgacgactggacggttaattatgcaatacgcatcacaaaacatcatccctgtcaca
ctcgaacttggtggcaaatcgccaaacattttcttccctgacgtcgcggaaaaagacgac
gaatttttcgataaagcgctcgaaggcttcacaatgtttgccttaaaccaaggcgaagta
tgcacatgcccgtcgcgcgctcttattcacgaatcgatttacgacgtctttatggagcgg
gcgcttgagcgcgtccaacaaattaagcaaggcaacccgctcgacacggaaacgatgatt
ggagcgcaagcatcgtctgaacaactcgagaaaattttgtcctacattgacatcggcaaa
caagaaggggcagagcttctcatcggcggcgaacgcaactttttagagggcgaattaagc
ggcggctattatgtgcaaccgactgtctttaagggacataataaaatgcgcattttccaa
gaagaaattttcggaccggtcgtttcggtcacgacgtttaaagacgaagacgaagcgctt
gccattgccaatgaaacgttatacggcttaggggcaggtgtctggagccgcaacatcaac
accgcttaccgcttcggtcgcggcattcaagcgggacgcgtctggacgaactgctaccac
gcgtatccagcgcatgcggcatttggcggttataaaatgtccggcattggccgcgaaacg
cataaaatgatgcttgaacattaccaacaaacgaaaaacttactcgtcagctactcgccg
aaaaaattaggattcttctaa

DBGET integrated database retrieval system