KEGG   Anoxybacillus amylolyticus: GFC30_468Help
Entry
GFC30_468         CDS       T04397                                 

Gene name
amyS
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00500  Starch and sucrose metabolism
aamy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GFC30_468 (amyS)
Enzymes [BR:aamy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GFC30_468 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ANB59369
UniProt: A0A167T2Z2
LinkDB All DBs
Position
complement(455493..457352)
Genome map
AA seq 619 aa AA seqDB search
MSLFKKIFPWIVSLLLLFSFIAPFSIQTEKVRAGSVPVNGTMMQYFEWYLPDDGTLWTKV
ANNAQSLANLGITALWLPPAYKGTSSSDVGYGVYDLYDLGEFNQKGTVRTKYGTKTQYIQ
AIQAAHTAGMQVYADVVFNHKAGADGTELVDAVEVNPSDRNQEISGTYQIQAWTKFDFLG
RGNTYSSFKWRWYHFDGTDWDESRKLNRIYKFRGTGKAWDWEVDTENGNYDYLMYADLDM
DHPEVVSELKNWGKWYVTTTNIDGFRLDAVKHIKYSFFPDWLSYVRTQTQKPLFAVGEFW
SYDTNKLHNYITKTNGSMSLFDAPLHNNFYIASKSGGYFDMRTLLNNTLMKDQPTLAVTL
VDNHDTEPGQSLQSWVEPWFKPLAYAFILTRQEGYPCVFYGDYYGIPKYNIPALKSKLDP
LLIARRDYAYGTQHDYIDNADIIGWTREGVAEKANSGLAALITDGPGGSKWMYVGKQHAG
KTFYDLTGNRSDTVTINADGWGEFKVNGGSVSIWVPKTSTTSQITFTVNNATTVWGQNVY
VVGNISQLGNWDPVNAVQMTPSSYPTWVVTVPLPQSQNIQFKFIKKDGSGNVIWENISNR
TYTVPTATSGAYTASWNVP
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtccctattcaaaaaaatctttccgtggattgtatctctacttcttttgttttcgttt
attgctcctttttccattcaaacagaaaaagtccgcgctggaagtgttccagtgaatgga
acgatgatgcaatatttcgaatggtaccttccagacgatggaacactatggacgaaagta
gcaaataacgcccaatctttagcgaatcttggcattactgccctttggcttccccctgcc
tataaaggaacaagcagcagtgacgttggatatggcgtttatgatttatatgacctagga
gagtttaatcaaaaaggaactgtccgaacaaaatacgggacaaaaacgcaatatatccaa
gcaatccaagcggcgcatacagcagggatgcaagtatatgcagatgtcgtctttaaccat
aaagccggtgcagacggaacagaactagtggatgcagtagaagtaaatccttctgaccgc
aatcaagaaatatcaggaacatatcaaatccaggcttggacaaaatttgattttcttggt
cgtggaaacacctattctagttttaaatggcgttggtatcatttcgatggaacggactgg
gatgagagtagaaaactaaatcgtatttacaagttccgcggcacaggaaaagcatgggat
tgggaagtagatacagaaaacgggaattatgactatctcatgtatgcagatttggatatg
gatcatccagaggttgtatccgaactaaaaaattggggaaagtggtatgtaaccacaacc
aatatcgacggattccgtctggatgcagtgaagcatattaaatatagctttttcccagac
tggctatcgtatgtacgaacccaaacacaaaagcctctttttgccgttggagaattttgg
agctatgacactaacaagctgcacaactatattacaaagacgaacggctctatgtcccta
ttcgatgccccgctgcataacaatttttatatagcatcgaaatcaggcggttattttgat
atgcgcacattactcaacaacacattgatgaaagatcagcctacattagcagtcacatta
gtggataatcacgatactgagccaggacaatctttacagtcatgggtcgagccatggttt
aaaccgttagcttacgcatttatcttgacccgccaagaaggttatccgtgcgtcttttat
ggagattactatggtattccaaaatacaacattcctgcgctgaaaagcaaacttgatccg
ctgttaattgcccgaagagattatgcctatggaacacagcacgactatattgacaatgcg
gatattatcggttggacgcgggaaggagtggctgaaaaagcaaattcgggacttgctgca
ctcattaccgacgggcctggcggaagcaaatggatgtatgttggcaaacaacacgctggc
aaaacgttttatgatttaaccggcaatcgaagtgatacagtgacaatcaacgctgatgga
tggggagaatttaaagtcaatggagggtctgtatccatatgggttccaaaaacatcaacc
acttcccaaatcacatttactgtaaataatgccacaaccgtttggggacaaaatgtatac
gttgtcgggaatatttcgcagctgggcaactgggatccagtcaacgcagttcaaatgacg
ccgtcttcttatccaacatgggtagtgacagtccctcttcctcaaagtcaaaacatacaa
tttaaatttatcaaaaaagatggatcaggaaatgtcatttgggagaatatatcgaatcga
acatacaccgtcccaactgctacatccggagcatatacagccagctggaacgtgccatag

DBGET integrated database retrieval system