KEGG   Anoxybacillus amylolyticus: GFC30_604Help
Entry
GFC30_604         CDS       T04397                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
aamy  Anoxybacillus amylolyticus
Pathway
aamy00071  Fatty acid degradation
aamy00280  Valine, leucine and isoleucine degradation
aamy00281  Geraniol degradation
aamy00362  Benzoate degradation
aamy00592  alpha-Linolenic acid metabolism
aamy01100  Metabolic pathways
aamy01110  Biosynthesis of secondary metabolites
aamy01120  Microbial metabolism in diverse environments
aamy01130  Biosynthesis of antibiotics
aamy01212  Fatty acid metabolism
Module
aamy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GFC30_604
   00592 alpha-Linolenic acid metabolism
    GFC30_604
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GFC30_604
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    GFC30_604
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GFC30_604
   00642 Ethylbenzene degradation
    GFC30_604
Enzymes [BR:aamy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     GFC30_604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ANB61566
UniProt: A0A160F580
LinkDB All DBs
Position
595769..596944
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVKETLKRAGNYEGNIDDLIIGCAMPE
AEQGLNIARNIGALAGLPYTVPAITINRYCSSGLQAIAYAAERIMLGHSDTIIAGGVESM
SLVPMMGHVVRPNVKLAESAPEYYMSMGHTAEQVAMKYGVTREDQDAFAVRSHQRAAKAI
QEGKFVDEIVPVEVTIRKLENNKLVEKTVLFSEDEGVRPDTNMETLAKLRPAFAVNGTVT
AGNASQTSDGAAAVMVMEREKAEALGLKPLGKFRSFAVAGVPPEVMGIGPVAAIPKALKL
AGLELSDIGLFELNEAFASQSIQVIRELGLDEDKVNVNGGAIALGHPLGCTGAKLTLSLL
HEMRRRNEQFGIVTMCIGGGMGAAGVFELIN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaagcggtcattgtagcgggggcgcgtacacctgtcggaaaagcaaagaaagga
acgcttgcccatgtgcgtccggatgatttaggggcgcttgtcgtgaaagaaacgttaaaa
cgggcaggaaattatgaagggaatattgacgatttaattatcggctgtgcgatgccggaa
gcggaacaaggattaaacatcgcccgcaacatcggagcgctagcagggcttccgtatacg
gttccggcaattacgatcaatcgctattgctcatctgggttacaagcgattgcttacgca
gcagagcgaattatgctcgggcattcagacacgatcatcgctggtggggttgagtcgatg
agccttgtgccgatgatggggcacgttgtacgtccgaatgtgaagttggcagaaagcgcg
ccagaatattatatgtcgatggggcatacggcagagcaagtagcgatgaaatacggcgtg
acgcgcgaagaccaagacgcatttgcggtgcgcagccatcaacgggcagcgaaagcgatt
caagaagggaaatttgtcgatgaaattgttcccgtcgaagtaactattcgcaagctcgaa
aacaataaactagtagaaaaaacggtgctcttttcagaagatgaaggggtgcgcccagat
acaaatatggaaacattggcaaagcttcgtccagcatttgctgtgaatggaacggtcacg
gctggaaacgcttcgcaaacgagcgatggcgccgcagcggtcatggtcatggagcgcgaa
aaagcagaagcattggggctaaaaccgcttggcaagtttcgttcgttcgcggtcgctggg
gtaccgccggaagtgatgggcatcggcccagtagcggcgattccgaaagcgttgaaattg
gcggggcttgaactttctgatatcgggttatttgaactgaacgaagcgttcgcttcccaa
tcgattcaggtcattcgcgaacttggtttagatgaagacaaagtgaatgttaacggcgga
gcaattgcgctcggtcatccgctcggatgcacaggagcgaaattaacattgtcgcttctt
catgaaatgcgccgccgcaacgagcaatttggcattgtcacgatgtgcatcggcggcggc
atgggtgcggcaggtgtgtttgaattaattaattaa

DBGET integrated database retrieval system