KEGG   Anoxybacillus amylolyticus: GFC30_78Help
Entry
GFC30_78          CDS       T04397                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
aamy  Anoxybacillus amylolyticus
Brite
Translation factors [BR:aamy03012]
 Eukaryotic Type
  Elongation factors
   GFC30_78 (tuf)
 Prokaryotic Type
   GFC30_78 (tuf)
Mitochondrial biogenesis [BR:aamy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GFC30_78 (tuf)
Exosome [BR:aamy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GFC30_78 (tuf)
  Exosomal proteins of breast cancer cells
   GFC30_78 (tuf)
  Exosomal proteins of colorectal cancer cells
   GFC30_78 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANB60367
UniProt: A0A160F2C4
LinkDB All DBs
Position
complement(61672..62859)
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEARAYDQIDAAPEERERG
ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEIPVIKGSALKALE
GDAEWEAKIIELMNAVDEYIPTPQREVDKPFMMPVEDVFSITGRGTVATGRVERGILKVG
DQVEIIGLSEEPKATTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVQRGQVLAKPGTI
TPHTKFKAQVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIQLPEGVEMVMPGDNIEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSQIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaattcgaacgtacgaaaccacacgttaacattggtacaatcggccac
gttgaccatgggaaaacaactttaacagcagcaatcacaacagttcttgcaaaacaagga
aaagcagaagcacgcgcttatgaccaaatcgacgctgctccagaggagcgtgagcgcgga
atcacaatctcaactgcacacgttgagtatgaaacagacaatcgtcactatgcgcacgtt
gactgcccaggccacgctgactacgtaaaaaacatgatcactggtgcagcacaaatggac
ggtgcgatccttgttgtatctgcagctgacggtccaatgccacaaactcgcgagcacatt
cttctttctcgccaagtaggcgtaccgtacatcgttgtattcttaaacaaatgcgacatg
gtagacgacgaagaactattagagcttgttgaaatggaagttcgcgacctattatctgaa
tacgacttccctggcgatgaaatcccagtaattaaaggttctgcattgaaagcacttgaa
ggcgatgctgaatgggaagcaaaaatcatcgagcttatgaacgcggttgacgagtatatc
ccaactccacaacgcgaagttgacaaaccgttcatgatgccagttgaggacgtattctca
atcactggtcgtggtacagttgctactggccgtgttgagcgcggtatcttaaaagttggt
gatcaagtagaaatcatcggtctttctgaagagccaaaagcaacaacggttacaggtgta
gaaatgttccgtaagcttcttgaccaagcagaagctggtgacaacattggtgcgcttctt
cgtggggtatctcgtgacgaagtacaacgtggtcaagtacttgcaaaaccaggtacaatc
acaccacatacaaaattcaaagcgcaagtttacgtcttgtcaaaagaagaaggtggacgt
catactccattcttctctaactaccgtccacaattctacttccgtacaacggacgtaaca
ggtatcatccaacttccagaaggcgttgagatggttatgcctggcgacaacatcgaaatg
acagtagaactaatcgcaccaatcgcgatcgaagaaggtacaaaattctcgatccgtgaa
ggtggccgtacagtaggcgcaggttctgtatctcaaatcatcgagtaa

DBGET integrated database retrieval system