KEGG   Aggregatibacter actinomycetemcomitans D7S-1: D7S_02347
Entry
D7S_02347         CDS       T02046                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
aan  Aggregatibacter actinomycetemcomitans D7S-1
Pathway
aan00052  Galactose metabolism
aan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    D7S_02347
Enzymes [BR:aan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     D7S_02347
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_2
Other DBs
NCBI-ProteinID: AFI88041
LinkDB
Position
2208422..2209402
AA seq 326 aa
MKAVVVEENRKLVLADIAMPKIEDGEDVLVKVLYSGVCGSDIPRIFHHGTHFYPIVLGHE
FCGTVTDIGKDATEFRKGELVVCAPLQPCFDCEECHKGYYSLCKNYNFIGSRRFGANAEY
ICVNKKNLVKVSPDSNPLHDAFIEPITVGLHAINLAQGCADKNVIVVGAGTIGLLAAQCA
EALGATQTFNSRELAAEEIEKRLLDSRFDQLVLETAGVPQSVELAIKIAGPRAQVALIGT
LHNDLTLNQKVFGFILRKELSIPGSWMNYSAPWPGGEWTKAIELVKQGKIQFDKLIASVN
FIEDYITEVEKLDGTPMNGKIVLKFQ
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaaagcggttgttgttgaagaaaacagaaaattggtgctggcggacattgcgatgccg
aaaatcgaagatggggaagacgtgctggtaaaagtactgtattcgggggtatgcggttcc
gatattccgcgcatatttcaccatggcacgcatttttaccctatcgtattagggcatgaa
ttttgcggtacggtgacggatataggaaaagacgcgacggaattccgcaaaggggagctg
gtagtttgcgcgccgttgcaaccttgtttcgactgcgaggaatgtcacaaaggatattat
tcgttatgtaaaaactacaatttcatcggttcccgtcgcttcggcgccaatgcggaatat
atttgcgtcaacaagaaaaatttggtgaaagtatcaccggattccaatcccttgcatgat
gcttttatcgaacctattacggtgggtctgcacgccattaatctggcgcagggttgtgcc
gataaaaatgtgattgtggtaggagccggtactattggcttgcttgccgcccagtgtgcc
gaagcgctgggtgctacgcaaaccttcaattcccgtgaattagccgcagaagaaattgaa
aaaagattacttgacagccgttttgaccaactcgtattggaaaccgccggcgttccgcaa
tcagttgaattagcaataaaaattgcaggtccgcgtgcgcaagtggcattgatcggcacc
ctacataatgatttaaccctgaatcagaaagtgttcggttttattttgcgcaaagaattg
agcattcccggttcttggatgaattattccgcgccgtggccgggtggtgaatggacgaag
gcaatcgaattggttaaacaaggtaaaattcaattcgacaaactgattgcgtcggtaaat
ttcattgaagattatattaccgaagttgaaaagcttgatggcacaccgatgaatggaaaa
atagtcttaaaatttcagtaa

DBGET integrated database retrieval system