KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0224
Entry
NT05HA_0224       CDS       T00929                                 

Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
  KO
K02535  UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.108]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00540  Lipopolysaccharide biosynthesis
aap01100  Metabolic pathways
Module
aap_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NT05HA_0224
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aap01005]
    NT05HA_0224
Enzymes [BR:aap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     NT05HA_0224
Lipopolysaccharide biosynthesis proteins [BR:aap01005]
 Lipid A
  NT05HA_0224
SSDB
Motif
Pfam: LpxC Omp85
Other DBs
NCBI-ProteinID: ACS96662
LinkDB
Position
217546..218463
AA seq 305 aa
MIKQRTLKQSIKVTGVGLHSGNKVTLTLRPAMPNTGVVYCRTDLNPPVTFPANANSVRDT
MLCTCLVNEEGVRISTVEHLNAALAGLGIDNIIVEVDAPEIPIMDGSASPFIYLLLDAGI
EEQNAPKKFVRIKQKVRVEDGDKWAEFSPYNGFRLNFTIDFNHPAINKDVRNYVMDFSAQ
AFVQQISRARTFGFMKDIEYLQSQGLALGGSLDNAIVLDDYRILNEDGLRFKDELVRHKM
LDAIGDLYMCGYNIIGDFKAYKSGHGLNNKLLRAVLANQEAWEFVTFDDKRQVPQGYVAP
AQVLI
NT seq 918 nt   +upstreamnt  +downstreamnt
atgattaagcaaagaaccttaaaacaaagtattaaagtaaccggtgtcggtttgcatagt
ggtaacaaagttaccttgactttgcgtccggcaatgccgaatacgggtgtggtttattgt
cgtactgatttaaacccgccggtaacattcccagctaatgcaaactcggtgcgtgatacc
atgctttgtacttgtttagtgaacgaagaaggtgtacgcatttcaactgttgagcatcta
aacgccgcgttagcgggtttaggtattgacaatattattgttgaagttgatgcgccggaa
attccaattatggatggtagtgcaagtccatttatttatttattacttgatgcgggtatt
gaagagcaaaatgcaccgaagaaatttgttcgtattaaacaaaaagtacgcgtagaggat
ggtgataagtgggcggagttttccccttataatggtttccgtttgaactttaccattgat
tttaatcatccggccattaacaaagatgtgcgtaattatgtgatggatttttctgcacag
gcctttgttcagcaaattagtcgcgccagaacctttggttttatgaaagatatcgaatat
cttcaatctcaaggtttggctttaggcggtagtttggataatgccattgtgcttgatgat
tatcgtattttaaatgaagacggcttgcgttttaaagacgaattagttcgtcacaaaatg
ttagatgctatcggtgatttatatatgtgtggttataacatcattggtgatttcaaagcc
tacaaatcagggcatggtttaaacaacaagctgttaagagctgtgttggcaaatcaggag
gcttgggagttcgttacctttgatgacaagcgacaagtgccacaaggttatgttgcaccg
gcccaagttttgatttaa

DBGET integrated database retrieval system