KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0370Help
Entry
NT05HA_0370       CDS       T00929                                 

Definition
(GenBank) lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase
  KO
K02560  lauroyl-Kdo2-lipid IVA myristoyltransferase [EC:2.3.1.243]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00540  Lipopolysaccharide biosynthesis
aap01100  Metabolic pathways
Module
aap_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NT05HA_0370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aap01005]
    NT05HA_0370
Enzymes [BR:aap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.243  lauroyl-Kdo2-lipid IVA myristoyltransferase
     NT05HA_0370
Lipopolysaccharide biosynthesis proteins [BR:aap01005]
 Lipid A
  NT05HA_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lip_A_acyltrans DUF4381 Wzy_C
Motif
Other DBs
NCBI-ProteinID: ACS96797
LinkDB All DBs
Position
381428..382384
Genome map
AA seq 318 aa AA seqDB search
MTDSQQNIRLTARVGYEPHFSWSYLKPKYWGVWLGILALLLLAFMPFRLRDKLAAKLGVF
IGHKAKKQRKRAQINLQYCFPQWTEQQREQVIDEMFAVLAQVMLGIGEIAVRSKKHLQKR
SEFIGIEHIKQAKEQGKNVILLVPHGWAIDASGIILHTHGIPMTSMYNPHRNPLVDWLWT
LARERFGGKMHARQNGIKPFLAHIRQGQMGYYLPDEDFGEEQSVYVDFFATYKATLPGIN
KMAKLAKAVVIPMFPRYNAEAGKYQMEIHPPMTLSDDPQQSARAMNEEIESFVTATPAQY
VWILQLLRTRKNGEDLYH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagattctcaacagaacattcgtttaaccgcacgtgtcggctatgagccgcatttt
tcatggtcgtatttaaaacccaaatactggggtgtttggctcggtatattggcactgttg
ttattggctttcatgccttttcgcttgcgtgataaattggctgccaaactgggcgtgttt
atcggacataaagcgaaaaaacaacgcaaacgggcgcaaattaatttgcaatattgtttt
cctcaatggacggagcaacaacgcgagcaggtgattgatgaaatgtttgccgtgttggcg
caagtaatgttaggtattggcgaaattgccgtacgttctaaaaaacatttgcaaaaacgg
agtgaatttatcggcattgaacacatcaagcaggcaaaagagcaggggaaaaacgtaatt
ttgttggtgccgcatggttgggcaattgatgcctccggcattattttacacacgcatggc
attccgatgacatctatgtataaccctcaccgcaacccgttggtggattggctttggaca
ttggcgcgggaacgctttggcggcaaaatgcatgcccgccaaaatggcatcaaaccgttt
ttagcgcatattcgtcaggggcagatgggctattatttaccggatgaagattttggcgaa
gagcagagcgtgtatgtggatttcttcgccacgtacaaagcaaccttgccgggcatcaat
aaaatggcgaaattggcgaaagcggtagtaattcccatgttcccgcgttataacgccgag
gcaggcaagtaccaaatggaaattcatccgccaatgacgttaagcgatgatccgcaacag
tcggcgcgtgccatgaacgaagaaatcgaaagttttgtcactgccactccggcccaatat
gtgtggatcttgcagctgttgcgtaccagaaaaaatggtgaagatctttatcattaa

DBGET integrated database retrieval system