KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0375Help
Entry
NT05HA_0375       CDS       T00929                                 

Definition
(GenBank) membrane protein, putative
Organism
aap  Aggregatibacter aphrophilus NJ8700
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YwiC 7TMR-DISM_7TM DUF2070
Motif
Other DBs
NCBI-ProteinID: ACS96802
LinkDB All DBs
Position
386431..387147
Genome map
AA seq 238 aa AA seqDB search
MKLLISNQHGAIVMALMPFLYGMLLGRPIWQHVFFLLAWFSLYLMTYPFLNLFKGRNLEL
YIKWSWIYFFACVIFAIPVVVYNWHTVLFVVAMLPLVLVSIHYVKQKDERAFLNDLVGII
IFAIAGMGSYYFPDRAFDHNIWLVALYPSLFFIGTTLYVKSVMRERKNPLYLKFSIGFHV
VCILVFLLFQQYLMAFAFVPPLIRAIWLPHKKLSVKQVGLTEMGISLLFFANLLYATL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactactaatttctaatcagcatggcgccatcgtaatggccttaatgccgtttcta
tacggaatgttactcggtcgccctatttggcaacatgttttcttcttattggcatggttt
tcgttatatttaatgacctatccgttcttaaatttatttaaaggcagaaatttagaactg
tatatcaaatggtcatggatatatttcttcgcttgtgtcatttttgccattccggtggta
gtttataactggcacactgtattatttgttgttgccatgttgccgttagttttagttagt
atccattatgttaagcaaaaagatgaacgtgcatttttaaatgatttagttgggattatt
atttttgctatcgccggtatggggtcttattacttccctgaccgtgcgtttgaccacaat
atttggttggtcgctttatatccaagtctattttttatcggaaccacattgtacgtaaaa
tcggtcatgcgtgaacgcaagaatccgttatatttgaaattctctattggttttcatgtg
gtttgtattcttgtcttcctcttgttccaacaatatttaatggcattcgcttttgtaccg
ccgttaattcgtgcaatttggttaccgcataagaaattatcggtaaagcaagttgggctc
accgaaatgggcatttccctcttgttttttgccaatttgttatatgctactttatga

DBGET integrated database retrieval system