KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0379
Entry
NT05HA_0379       CDS       T00929                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00061  Fatty acid biosynthesis
aap00780  Biotin metabolism
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01212  Fatty acid metabolism
aap01240  Biosynthesis of cofactors
Module
aap_M00083  Fatty acid biosynthesis, elongation
aap_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NT05HA_0379
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NT05HA_0379
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NT05HA_0379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aap01004]
    NT05HA_0379
Enzymes [BR:aap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NT05HA_0379
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NT05HA_0379
Lipid biosynthesis proteins [BR:aap01004]
 Fatty acid synthase
  Component type
   NT05HA_0379
SSDB
Motif
Pfam: adh_short_C2 adh_short DUF4570
Other DBs
NCBI-ProteinID: ACS96806
LinkDB
Position
complement(390114..390902)
AA seq 262 aa
MGFLTGKRILVTGLASNRSIAYGIAKAMKEQGAELAFTYLNEKLQPRVEEFAKEFGANIV
LPLDVATDESIQNCFAELRKHWDKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKD
GIRVNAISAGPIRTLAASGIKNFKKMLATFEKTAALRRTVTIEDVGNSAAFLCSDLASGI
TGEIVHVDAGFSITAMGELGEE
NT seq 789 nt   +upstreamnt  +downstreamnt
atgggtttcttaacaggtaaacgtattttagtcacaggtctcgccagcaaccgttctatc
gcttacggtatcgctaaggccatgaaagaacaaggtgcagaattagccttcacttattta
aatgaaaaattacaaccgcgtgttgaagaatttgccaaagaatttggcgcaaacatcgtt
cttccgttagacgttgccaccgatgaaagcattcaaaactgcttcgcagaattacgcaaa
cactgggataaatttgatggttttgtacacgccatcgcattcgcaccgggcgatcaatta
gacggcgactatgtgaatgcggcaacccgtgaaggttatcgcattgcccacgacatcagt
gcatacagttttgtagcaatggcgcaagcagcacgtccatatttgaatcctaacgcggca
ttattaaccctttcttacttaggtgcagaacgtgccattccaaactataacgtgatgtgt
ttagccaaagcctctcttgaagcggcaacccgtgtgatggcagcagatttaggtaaagac
ggcattcgcgtgaacgccatttccgcaggcccaattcgtaccttggcggcttccggtatt
aaaaacttcaagaaaatgttggcaaccttcgagaaaaccgctgcattacgccgtaccgtg
accattgaagatgtgggcaactccgcggcgttcttatgctctgatttagcatccgggatc
accggtgaaatcgtccatgttgatgcaggcttcagcatcaccgccatgggcgagttaggc
gaagaataa

DBGET integrated database retrieval system