KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0427Help
Entry
NT05HA_0427       CDS       T00929                                 

Definition
(GenBank) peptidase T
  KO
K01258  tripeptide aminopeptidase [EC:3.4.11.4]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
KEGG Orthology (KO) [BR:aap00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aap01002]
    NT05HA_0427
Enzymes [BR:aap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.4  tripeptide aminopeptidase
     NT05HA_0427
Peptidases and inhibitors [BR:aap01002]
 Metallo peptidases
  Family M20
   NT05HA_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ACS96848
LinkDB All DBs
Position
433170..434420
Genome map
AA seq 416 aa AA seqDB search
MQDLLSKEPALERFFNYVTYDTQSKLGAKNSPSSSGQLTLAKYLQQELVALGLQDIVLSK
HCVLTAFLPSNVDLNAPTIGLISHLDTSPDCSGKNVQPEVIENYRGGDIALGIGEEFISP
VYYPFLHQLIGKTLIVADGNTLLGADNKSGIAEIMTALYRLKTENLPHCNIRVAFTPDEE
IGLGMQFFPFDDFLCDWAYTIDGGAVGELEYENFNAASAKVTFYGRNIHTGSAKNKLTNA
LALACEFQQSFPQAETPENTEQREGFFHLNHFSGDIEKAELHYLIRDFDGAEFEKRKQFI
RDLVSQFNQRKRLSKVIELELTDSYKNMYETVKQVPQSIALADLAMKQCGITPNHKLIRG
GTDGAWLAEKGLACPNIFTGGYNFHSKHELITLEGMKDAVNVIVKVVELATQKSFS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttactatctaaagaaccggctttggaacgtttttttaattatgttacttat
gatacccaatctaaactaggtgcaaaaaactcacctagctcttcaggtcaacttaccctt
gccaaatacttacaacaagagcttgttgcgttgggattacaagacattgtgttgagtaaa
cattgtgttctcacggcatttttaccttctaatgtggatttaaacgcgcctactatcggc
ctcatttcgcatttagatacctcgcctgattgtagcggcaaaaatgtacaacctgaagtt
atcgaaaattatcgtggcggtgacattgctttaggtatcggcgaagagtttatcagccct
gtctattatcctttcttgcatcagctcatcggcaaaactttgattgtggctgatggaaat
accttattgggtgctgataacaaatctggaatagcggaaattatgaccgcactttatcgt
ttaaaaacggaaaatttacctcactgtaatattcgagttgcattcacacctgatgaagaa
atcggtctcggtatgcaattttttcctttcgatgattttctatgcgattgggcttatacc
attgatggtggggctgtgggggaactggagtatgaaaactttaatgcggcttctgctaaa
gtgactttttacggacgcaatattcacaccggttcagcaaaaaataaactgactaacgca
ttagccctcgcttgtgaatttcagcaatcttttccacaagcagaaacccctgaaaacacc
gaacagcgagagggttttttccatttaaatcatttttccggcgatattgaaaaagcagag
ttgcattatctcattcgtgattttgatggggcagaatttgaaaaacggaaacagtttatt
cgtgatttagtgtctcaatttaatcagcgaaaacgtttatcaaaagtgattgaactggaa
ctgaccgacagctataaaaatatgtatgagacggtaaaacaagtgcctcaatctatcgcg
ctggcggatcttgccatgaaacaatgtggaattacaccaaatcataaactcattcgaggg
ggcaccgacggtgcttggttagcagaaaaagggctggcttgtccgaatattttcaccggc
gggtataattttcatagtaagcatgaattgattacgcttgaaggcatgaaagacgcggtg
aatgtaattgtgaaagtcgtggaattggcaactcaaaaatcgtttagctaa

DBGET integrated database retrieval system