KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0453Help
Entry
NT05HA_0453       CDS       T00929                                 

Definition
(GenBank) AmpG protein
  KO
K08218  MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aap00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NT05HA_0453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aap02000]
    NT05HA_0453
Transporters [BR:aap02000]
 Major facilitator superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    NT05HA_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Acatn
Motif
Other DBs
NCBI-ProteinID: ACS96868
LinkDB All DBs
Position
complement(463610..464884)
Genome map
AA seq 424 aa AA seqDB search
MTTPASNPTLASQIFSRNMLICVFTGFSSGLPLFVLLQMLPVWLTDKGLSVELIGVVTGV
TLPYGLKFLWAPLLDRYFPNFLGRRRSWLLISQIILLILLYAISQFDPSSQLTIVANIAF
LIAFFSATQDIVLDAYRREILTDKELGLGNTIHINAYRVAGLIPGGLSLYLATRLPWETV
FLLTALCMLFGLFMTLFLAKEPKIAVQDRDKPFYLAFWIPLQAFFQRKGVAQALGFLLFL
FLYKFGDSFATTLQTKFIYDMGFSKDDIAIVVKSTSLWASISAGLAGGVIMIKLGINRAL
WVFGFVQLITIGGFVWLAGFGHFAQITAIELWKLGFVIAAEYIGVGLGTAAFVAFMARET
NPLYTATQLALFTSLSALPSKGFGMLSGYLVKAVGYYNFFWICLLLAVPGMLCLFWVAPW
NEKE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccagcctctaacccaacccttgcaagccaaattttcagccgtaacatgctg
atttgtgtttttaccggctttagctcaggtctccctctatttgttttattgcaaatgttg
ccggtatggctgacggataaagggctttctgttgaactgatcggcgtagtgacgggtgtc
accctcccctacggtttaaaatttttatgggcccccttattggatcgctattttccaaac
tttctagggcggcggcggagctggttgcttatttctcaaatcattttactgattttactc
tatgccattagccaattcgatccgagttcacaattaactattgtggcgaatatcgctttt
cttattgctttcttctcagcaacccaagatattgtacttgatgcctatcgacgtgaaatt
ttaacggataaagaacttggcctgggcaacaccatccacattaatgcttatcgtgtcgcg
ggtttaatccccggtgggctgtctctttatctcgccacccgcctcccttgggaaactgtt
tttttattgaccgcactttgtatgctattcggtttgtttatgaccttatttctcgccaaa
gagccgaaaattgctgttcaagatcgcgacaaaccattctatcttgccttttggatcccg
cttcaggcgttctttcagcgtaaaggtgtggcacaagccttgggctttttgcttttccta
tttttatataaatttggtgattctttcgctaccacgctacaaaccaaatttatctatgat
atgggctttagcaaagatgacatcgccatcgtagtaaaaagtacgtcactctgggccagc
atttccgccggactcgcgggcggcgtaattatgataaaactcggcattaaccgtgcgctg
tgggtctttggtttcgtacaattaatcaccatcggcggatttgtttggttggcaggattc
ggacattttgcacaaattaccgcgatcgaactgtggaaactcggcttcgtgattgccgcc
gaatacatcggtgtaggcttgggaactgccgctttcgtcgcgttcatggcacgggaaacc
aatccgctttacaccgctacgcaattggcgctgttcaccagtctttccgcgttaccaagc
aagggattcggcatgttgtcgggctatttggtcaaagcggtgggttactataatttcttc
tggatctgtttattacttgctgtacccggaatgctttgtttattctgggtagctccgtgg
aatgagaaagaataa

DBGET integrated database retrieval system