KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0455Help
Entry
NT05HA_0455       CDS       T00929                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00052  Galactose metabolism
aap00520  Amino sugar and nucleotide sugar metabolism
aap01100  Metabolic pathways
Module
aap_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NT05HA_0455
   00520 Amino sugar and nucleotide sugar metabolism
    NT05HA_0455
Enzymes [BR:aap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     NT05HA_0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind KR adh_short NAD_binding_4 NmrA NAD_binding_10 adh_short_C2 TrkA_N UDPG_MGDP_dh_N HHH_5
Motif
Other DBs
NCBI-ProteinID: ACS96870
LinkDB All DBs
Position
complement(465235..466251)
Genome map
AA seq 338 aa AA seqDB search
MTILVTGGAGYIGSHTVVELLNAGKEVVVLDNLCNSSPKSLERVKEITGKTVKFYEGDVL
DRALLQKIFAENTIHSVIHFAGLKAVGESVQKPAEYYLNNVTGSLVLVQEMKKAGVWNFV
FSSSATVYGDPEIIPITESCKVGGTTNPYGTSKFMVEQILRDIAKAEPKFSMTILRYFNP
VGAHASGLIGEDPNGIPNNLLPYISQVAIGKLPQLSVFGSDYDTHDGTGVRDYIHVVDLA
IGHLKALDRHQDDAGLHIYNLGTGMGYSVLDMVNAFEQANDIQIPYKLVDRRPGDIATCY
SDPSLAEKELGWKAERGLTEMMKDTWNWQKNNPKGYRD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgactattttagtaacaggcggtgccggctatatcggttcacacacagtcgttgaatta
ttaaatgcgggcaaagaagtggtagttttagacaacctttgtaactcctcaccgaaatcg
ttagaacgggttaaagaaattacaggaaaaactgttaaattttatgaaggagacgtgttg
gatcgtgcattgttacaaaaaatctttgccgaaaataccattcattccgtcattcatttc
gccggcttaaaagcggttggcgaaagtgtgcaaaaacctgccgaatattatttaaacaac
gtgaccggatccctcgtcttggtacaagaaatgaaaaaagccggcgtgtggaattttgta
ttcagctcttccgccaccgtttatggcgatcctgaaattatcccgattacagaaagctgc
aaagtaggcggcactaccaacccgtatggcacttccaagtttatggtagaacaaatcctg
cgcgacattgccaaagcggaacccaaattcagcatgaccattttgcgatatttcaatccc
gtgggcgcgcatgcaagtggcttaatcggcgaggacccaaatggcattccgaataatctc
ttaccttatatcagccaagtggcaatcggcaagttaccacaactttccgtctttggtagc
gattatgacacccatgacggcacaggtgtgcgcgattatattcacgttgtggatttggct
atcggtcacttaaaagcgctggatcgccatcaagatgatgccggtttgcacatttataac
ttgggcaccggtatgggttattccgtgttggatatggtaaacgcctttgaacaggcgaac
gatattcaaattccgtataaattggttgatcgtcgtccgggcgacattgccacttgttat
tccgatccgagtttagcggagaaagaattaggctggaaggcggaacgtggattaacagaa
atgatgaaagatacatggaattggcaaaaaaataacccgaaaggttatagagattaa

DBGET integrated database retrieval system