KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0479Help
Entry
NT05HA_0479       CDS       T00929                                 

Definition
(GenBank) conserved domain protein
Organism
aap  Aggregatibacter aphrophilus NJ8700
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdaS_antitoxin HTH_3 P22_Cro
Motif
Other DBs
NCBI-ProteinID: ACS96894
LinkDB All DBs
Position
483031..483243
Genome map
AA seq 70 aa AA seqDB search
MKNEAIEKAISICGSQVKLSQECGVSQVSVSFWLNGGGINAKYIPRIVKATKGKVTEKQI
LHSLANLTDN
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgaggcaatcgaaaaagcaatttcaatttgcggttctcaggtaaagctaagt
caagaatgcggagtttctcaggtttccgtcagcttttggcttaatggtggcggtattaac
gctaagtatatcccgcgaatcgttaaggctacaaaaggcaaggtgactgaaaagcagatt
ttacattccttagcaaatttaactgacaactaa

DBGET integrated database retrieval system