KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0480Help
Entry
NT05HA_0480       CDS       T00929                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aap  Aggregatibacter aphrophilus NJ8700
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF533 TerB
Motif
Other DBs
NCBI-ProteinID: ACS96895
LinkDB All DBs
Position
483292..483735
Genome map
AA seq 147 aa AA seqDB search
MAMKKVIIEMIENIPGGKSAVAGFLGFSEAELNNRLYQTKGQRFKDEELIAIQQEFGLTD
YTEELCRLTGGCFVPHPEADQLDSVEISVLQLHEQSARGLLFEVLETALADGEITSHEED
KIRRALDKHLAATQHTIECVISLNKRQ
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaagaaagtcatcatcgaaatgattgagaacataccgggcggcaaaagtgcg
gtggcgggatttctcggattttcagaggcggaattaaacaatcggctttatcagacgaaa
gggcagcggttcaaagacgaagagttgatcgcaattcaacaagaatttgggctgaccgat
tacacggaagaattatgccgtttaaccggcggttgttttgtaccgcaccctgaagcagac
cagttagacagcgtagaaatttccgtgctgcaactgcatgaacaatccgcgcgtggattg
ctgtttgaagtgcttgaaactgcattagcagacggtgaaatcacttctcacgaagaagac
aaaatccgtcgcgcattagataaacacttggcggcgacacaacacactattgagtgcgtt
atttcgctaaataaacggcaataa

DBGET integrated database retrieval system