KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0488Help
Entry
NT05HA_0488       CDS       T00929                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aap  Aggregatibacter aphrophilus NJ8700
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_antitermQ DUF1133
Motif
Other DBs
NCBI-ProteinID: ACS96903
LinkDB All DBs
Position
487680..488186
Genome map
AA seq 168 aa AA seqDB search
MRKFSELELTEEQEEFVDKHMYPWGAWIRLGRLDKPEFNIIAKLMKSVIPADPSEPVCSD
EVGMMISELIEQFFFKNDRTLHYIVFSYYVNKNTINRIAVKLRENCGEMKMQPCAGKSDI
RIPSLKTVKRNVEKELKLAKAIIHELLVTGFVILRTGRQNAKSIKITY
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatttagcgaattagaactaaccgaggaacaggaagaatttgttgataagcac
atgtacccatggggtgcgtggattagattgggtagattagacaagcctgagtttaatatt
atcgctaaactaatgaagagcgtgattccggcggatccaagcgaaccggtttgcagcgat
gaagtcggcatgatgattagtgagcttatcgagcaattcttcttcaagaacgaccgcact
ttacactatatcgtgttctcgtattacgtaaacaaaaacacgatcaatcgcatagccgtt
aaactgcgtgagaactgtggagagatgaaaatgcagccgtgcgccggtaagtcagatatt
cgcattccaagccttaaaacagtgaagcggaatgttgaaaaagagctaaaactagcaaaa
gcaataattcacgaactgcttgtaactggtttcgttattcttcgaactgggcgacaaaat
gcaaaaagtatcaaaattacatattga

DBGET integrated database retrieval system