KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_0713Help
Entry
NT05HA_0713       CDS       T00929                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, (gpd-m) (gpdh-m)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00564  Glycerophospholipid metabolism
aap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT05HA_0713
Enzymes [BR:aap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NT05HA_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_2 NAD_binding_8 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACS97110
LinkDB All DBs
Position
717170..718762
Genome map
AA seq 530 aa AA seqDB search
MQRNTELEKVKNTEKWDFIVIGGGASGLGIALDAASRGYKTLLLEGYDFAKGTSSRSTKL
VHGGVRYLAAGDVALVKEALRERGRLSKNASHLFKNQNFIIPNYNFVDSVKYRIGLGLYD
YLSADLSLGKTIAINKDTTMERLPTLNGKGLKNGVVYKDGQFDDSRLAINIAQTVVEQGG
TVLNYAKVVELLKDAQGKVNGVKFVDELNGEEFCVNGTAVINATGVFMNDILSMDHGTDK
KFVVPSQGVHLVLDKSFLPSDDALMIPKTSDGRVLFAVPWHERIVVGTTDTLMKEPSYEP
VALEQEIQFILDTAGQYLTKKPTRDDVLSIFAGLRPLAAPEKSGQSTKEVSRSHKVVVSD
SGLVTITGGKWTTYRQMSEDTVEEALKAHPQLAKKACVTTNLAIHGKISAEQVDLRNHLY
IYGSDIPAIKALETENPAFAAKIHPRHPNTVAEVVWAVREEMAESVEDVLARRVRLLFLD
ARAAIDSAAKVANIMAKELKKDVQWERDQTAKFLDIAKHYLLVDYAPQVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaatacagaacttgaaaaagttaaaaatactgaaaaatgggattttattgtt
attggcggtggtgctagtggtttgggtattgcgttagacgcagcttcccgtggctataaa
actcttttattagaagggtatgactttgctaaaggtacatcaagtcgtagtacaaaatta
gtacacggtggtgttcgttatttggccgctggtgatgttgctttagtaaaagaggccttg
cgtgaacgtggtcgtttatcaaaaaatgcttcacatttatttaaaaatcaaaattttatt
attcccaattataattttgtagatagtgtgaaataccgcattggtttaggtttatatgat
tatttatccgccgatttaagtttgggtaaaacgattgcgattaataaagacaccacaatg
gaacgtttgcctacgttaaatggcaaaggtttgaaaaacggggtcgtatataaagacggt
caatttgatgattcccgtttggcaattaatattgcacaaactgtggttgagcaaggcggt
accgtattaaattacgccaaagtagttgaattattaaaagatgcccaaggcaaagttaac
ggcgttaagtttgttgatgaattaaatggtgaggaattctgcgtaaacggcacggcagta
attaatgctaccggtgtgtttatgaacgatattttatctatggatcacggtactgacaaa
aaattcgtggtgccaagccaaggggttcaccttgttttagataaatctttcttgccaagt
gatgatgcattaatgattccaaaaacttctgatggccgtgtgttgtttgccgtgccatgg
catgaaagaattgtcgtaggaacaaccgatacattgatgaaggagccttcttatgagccg
gttgccttagaacaagaaattcagttcattttggatactgccggccaatatttaacgaag
aaaccaactcgcgacgatgtgttgagtattttcgccggtcttcgtccattggcagcaccg
gaaaaatccggtcaaagcactaaggaagtttctcgtagccataaagttgtcgtaagtgat
agtggtttggtaacaatcactggtggtaaatggacaacttatcgtcaaatgtctgaagat
actgttgaggaagccttgaaagcgcatccacaattagcgaaaaaagcttgtgtcacgact
aatttagctattcacggcaaaatctcggcagagcaagtggatctaagaaaccatctttat
atttacggatctgacattcctgcaattaaagcattagaaaccgaaaaccctgcatttgcc
gcgaagattcatcctcgccatccaaatacggttgctgaagtggtttgggctgtgcgtgaa
gaaatggctgaatcagtagaagatgtattagcccgtcgtgttcgtttgctattcttagat
gcgcgtgcagccattgatagtgcagcaaaagtcgctaatattatggcaaaagagttgaaa
aaagacgtgcaatgggaacgtgatcaaacggcaaaattcttagatattgcaaaacattat
ttacttgttgattacgcgccacaagtcgcctaa

DBGET integrated database retrieval system