KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1071Help
Entry
NT05HA_1071       CDS       T00929                                 

Definition
(GenBank) ABC transporter, CydDC cysteine exporter
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aap00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NT05HA_1071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aap02000]
    NT05HA_1071
Transporters [BR:aap02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    NT05HA_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N DUF87 FPN1 AAA_30 AAA_22 AAA_16 MMR_HSR1 ATP-synt_ab T2SSE AAA_23 AAA_29 RsgA_GTPase PilJ NACHT TrwB_AAD_bind FtsK_SpoIIIE AAA_7 AAA_18 AAA_24 DUF815
Motif
Other DBs
NCBI-ProteinID: ACS97437
LinkDB All DBs
Position
1083487..1085220
Genome map
AA seq 577 aa AA seqDB search
MRALLPFIRLFKFAKWPLFLGGLLMILSLASSIGLLTLSGWFLAATAIAGFGTLFNFFYP
SASVRGLAISRTVARYFEKVVTHDATFRVLAKLRVQVFSKIIPLSPAVLNRYRNSDLLNR
LVADVDTLDSLYLRLVAPFISAIVVILMMTIGLSFINMPLALFIGGTLLVLLLVIPTIFY
RLGTKFGAKLTQSRATYRTQFVEFIQAQAELLLFNSEAKVKEKLQQTEQQWQAYQQQEAN
LSGFSTALLLLANGLVLSITLWAASQADLGNDEYRAAFIGLFTFAALAAFEILMPLGAAF
LHIGQVIASAERVSDIIEQQPLVKFSGTERVEFNTAQPLLSVQNLDFHYPQRSNPALIEL
NLTIQTGQKIAILGKTGSGKSTLLQLLVRNYDADQGRIVLAGKEIQRYSEQSLRQQFCFL
TQRVHVFSDSLRKNLQIATHTPISDEKMMVILQQVGLEKLLQQEQGLDLWLGDGGRPLSG
GEQRRLGLARILLNDAPILLLDEPTEGLDRETERKMLQAILAHSANKTLIMVTHRLTAIE
QFDQLVIIDNAKLIEQGTYQDLVNKENGFFKQLTQRI
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctttacttccttttattcgcttattcaaatttgctaaatggccattgttcttg
ggcggtctattaatgatcttgagcttggcttccagtatcggtttgttaacactttccggc
tggttcttggctgctaccgccattgcgggctttggcacattatttaactttttctaccct
tccgccagcgtgcgcggattagccatcagccgcacggttgcccgctattttgagaaagtc
gtcacccatgacgccaccttccgcgtattggcgaaattgcgcgtgcaagtgtttagcaaa
atcattccgcttagcccggctgtattaaatcgctatcgcaacagtgatttattaaaccgt
ttggttgccgacgttgacaccttagacagcctgtatttacgccttgtcgccccatttatc
agtgccattgtcgtgattttgatgatgacgatcggcttgagttttatcaatatgccattg
gcgttattcatcggtggaaccttattggttttattattggtgatcccgaccattttttac
cgtttaggcacaaaattcggtgcaaaattaacgcaatcccgtgccacttatcgcacacaa
tttgtcgaatttatccaagctcaggcggaattattactatttaacagcgaagctaaagtt
aaagaaaaattgcaacaaaccgaacaacaatggcaagcctatcaacaacaggaagcaaat
ttatccggattttccaccgcacttttattgcttgccaacggtttagtgctctccattacc
ctttgggccgcttctcaggcagatttaggcaacgatgaataccgcgccgcctttatcggt
ttatttacttttgctgcccttgcggcatttgaaattctgatgcctcttggtgcggcattt
ttacatatcggacaagttatcgcgtcagctgaacgggtcagcgacattattgagcaacaa
cccttagttaaattttccggtacggagcgagttgaattcaacaccgcacaaccgttgtta
agcgtgcaaaatctcgattttcattatccgcaacgaagcaatccggcattaatcgaattg
aatttaactattcaaacaggacaaaaaatcgccattttaggtaaaaccggtagcggaaaa
tccactttattacaactcttggttcgtaattatgacgctgaccaaggacggattgtctta
gccggtaaagagattcaacgttacagtgaacaaagtttacgtcaacaattctgtttctta
actcaacgggtacacgtatttagtgacagcctgcgcaaaaacctgcaaattgctactcat
acgccaatcagcgatgagaaaatgatggtgattttgcaacaagtgggattagagaaacta
ttacaacaggaacaaggcttggatttatggctgggtgacggcggtcgtccgttatccggc
ggtgaacaacgccgtttgggattggcgcgtattctattaaatgatgccccgattttattg
ttagatgaaccgacagaaggtttagatcgcgaaaccgagcgtaaaatgctacaagctatc
ctagcacacagcgccaataagaccttgattatggtgacacaccgcttaacggcaattgag
cagttcgatcagttggtgattatcgataatgccaaacttattgaacaaggaacttatcaa
gacttggtgaataaagaaaacggctttttcaaacaactcacacagagaatttag

DBGET integrated database retrieval system