KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1258
Entry
NT05HA_1258       CDS       T00929                                 

Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00052  Galactose metabolism
aap00520  Amino sugar and nucleotide sugar metabolism
aap01100  Metabolic pathways
Module
aap_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
aap_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NT05HA_1258
   00520 Amino sugar and nucleotide sugar metabolism
    NT05HA_1258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aap04147]
    NT05HA_1258
Enzymes [BR:aap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     NT05HA_1258
Exosome [BR:aap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT05HA_1258
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Other DBs
NCBI-ProteinID: ACS97616
LinkDB
Position
complement(1266419..1267573)
AA seq 384 aa
MTPIQKSQHIFNQKYNKQPELTVYAPGRVNIIGEHTDYNDGFVMPCAINYGTAIAGAKRN
DHVWNVYAADLDLSDEFSLEKEIPQSEQKWANYVRGVVKFIQERCPDFKQGADLVISGNV
PHSSGLSSSAALEVATGKFCQQLGDLPLSHTEIALIGQKAENKFVGANCGNMDQLISALG
QQDHLLMIDCRSLETQPTPVPHDVAVIIVNSNVPHDLVTGEYNTRRQQCERAAAFFGVKA
LRDVSVAQFKEKEPELTALDPLVAKRARHVVTENQRVLDAVEALKHNDLTRLGELMGQSH
DSMRDDFEITVPQIDYLVELAQLVIGKQGGARMTGGGFGGCIVALAPHDKVEAVRKIVAD
NYEKQTGLKEDFYVCTASQGAHLC
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaccccaatccaaaaatcccaacatattttcaaccaaaaatacaataaacaacctgag
ttgaccgtgtatgctcccggtcgcgttaatatcatcggcgaacataccgactacaacgat
ggctttgtgatgccatgcgccattaactatggcacggcgattgccggagcgaaacgcaac
gatcatgtttggaatgtgtatgctgccgatttggatctgtctgatgagttttcgctagag
aaagaaatccctcaaagtgaacaaaaatgggcaaattatgtgcgtggcgtggtgaaattc
attcaggaacgttgccctgattttaaacaaggggcggatttggtgatttccggtaacgtg
ccgcattcttccggcttgagttcttctgctgcgttagaagtggcaacaggaaaattctgt
cagcagctgggtgatttgcctttaagccatacggagattgcgcttatcggacaaaaagcg
gaaaacaaatttgttggtgccaactgtggcaatatggatcagctgatttctgcgctcgga
caacaagatcatttattgatgattgactgccgtagtcttgaaacccaaccaacaccagtg
ccgcacgatgtggcggtaattatcgtgaactctaatgtgccgcatgatttggttaccggc
gaatacaacacccgccgtcagcaatgtgaacgtgcagcggcgtttttcggcgtgaaagcc
ctgcgcgatgtgtcagtggcacaatttaaagaaaaagaaccagaattgaccgcacttgat
ccgctggtcgcaaaacgcgcccgccatgtagtcacggaaaatcaacgcgtgttagacgcg
gtagaggccttgaaacataacgacttaacccgtcttggcgaattaatggggcagtcgcac
gattccatgcgagacgattttgaaatcaccgtgccacaaattgactatttagtggaattg
gcgcagctggtcatcggtaagcagggtggcgcacgcatgacaggaggtggtttcggcggt
tgtatcgttgctcttgcgccacacgataaagtggaagctgtacgtaaaatcgtggcagac
aattatgaaaaacaaacaggcttgaaagaagacttctatgtttgtaccgcttcgcaagga
gcacacctatgctag

DBGET integrated database retrieval system