KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1367Help
Entry
NT05HA_1367       CDS       T00929                                 

Definition
(GenBank) ribonuclease T
  KO
K03683  ribonuclease T [EC:3.1.13.-]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
KEGG Orthology (KO) [BR:aap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aap03016]
    NT05HA_1367
Enzymes [BR:aap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     NT05HA_1367
Transfer RNA biogenesis [BR:aap03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    NT05HA_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051
Motif
Other DBs
NCBI-ProteinID: ACS97719
LinkDB All DBs
Position
1378998..1379651
Genome map
AA seq 217 aa AA seqDB search
MSETQETINYNLLKHRFRGYLPVIIDVETAGLNAKTNALLELAAITVKMDDNGHLVPDQK
CHFHIQPFEGANIDPESIKFNGIDIDNPLRGAISENIAISEMFKMVRRAQKDAECQRSII
VAHNAAFDQGFIMAAAQRTNAKRNPFHPFSTFDTATLSGFMFGQTVLIKACQAAKIPFDG
SQAHSALYDTERTAELFCYMVNHLKTLGGFPHIATED
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacacaagaaaccataaactataatctcttaaaacatcgtttccgtggctat
ttaccggtaattattgatgtggaaaccgcaggcttgaatgctaaaaccaatgcattgtta
gaactggcagcaattacggtaaaaatggatgacaatggtcatttggtaccggatcaaaaa
tgccatttccacattcaaccttttgaaggcgcaaatatcgatcctgaatccattaaattt
aacggcattgacattgacaacccgctgcgcggtgccatcagtgaaaacattgccatcagc
gaaatgtttaaaatggtacgccgcgcacagaaagatgccgagtgccaacgctcgattatt
gtggcgcataatgcagcctttgatcagggctttattatggcagcagcacaacgcaccaac
gccaaacgcaacccatttcaccctttttccacctttgatacggcaaccctaagcggtttt
atgtttggtcaaacggtgttaattaaagcctgccaagcggccaaaatcccttttgatgga
tcacaagcacactctgccctctacgatacggaacgtactgcagaattattttgttatatg
gtgaatcacttaaaaacactgggtggatttccacatattgcgacagaagattaa

DBGET integrated database retrieval system