KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1723Help
Entry
NT05HA_1723       CDS       T00929                                 

Definition
(GenBank) ribonuclease T2 family
  KO
K01166  ribonuclease T2 [EC:4.6.1.19]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Brite
KEGG Orthology (KO) [BR:aap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aap03016]
    NT05HA_1723
Enzymes [BR:aap01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.19  ribonuclease T2
     NT05HA_1723
Transfer RNA biogenesis [BR:aap03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    NT05HA_1723
 Prokaryotic type
    NT05HA_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_T2
Motif
Other DBs
NCBI-ProteinID: ACS98054
LinkDB All DBs
Position
1713191..1713886
Genome map
AA seq 231 aa AA seqDB search
MNEKRMLLLSFFVVAFLMFLLAGWYYFSQQKQAVGVVVDRDYDYIMKNDPIGQNKNAQTD
YYTLVLSWSPAFCDSQRKQYGNELPNSLQYQCGLTQQFGWIVHGLWSQNKQARRVNEHPR
FCQGDLPKLPQELIERYLPEMPSASLLQGEWEKHGACIFDNAKDYFEKIKNLYRTLKLPN
YELSRNELFKWVKSNNPQLKNAYLGAARNELFICYDLDWQVMDCPSSRTGY
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaaacgtatgttgctactgtctttttttgtggtggcttttttaatgttttta
ctcgccggctggtattatttttcccagcagaaacaagcggttggtgtcgttgtcgatcgg
gattacgactacattatgaaaaacgaccccatcggccaaaataaaaacgcgcaaaccgac
tattacacactggttctttcttggtcgccggcgttttgcgatagtcaacgtaaacaatat
ggcaacgagttgccgaattcactgcaataccaatgtggtttaacacaacaattcggttgg
atcgtacacggcttatggtcacaaaacaaacaagccagacgtgtcaacgagcatccgcgt
ttttgccaaggcgatttaccaaaattaccgcaagaactcatcgaacgttatttgccggaa
atgccaagcgccagtttgttacaaggcgaatgggaaaaacacggcgcctgtatctttgac
aatgccaaagattactttgaaaaaatcaaaaatttataccgcactttgaagttaccgaac
tatgaattaagtcgtaacgagctgtttaaatgggtgaaaagcaataacccacagctcaaa
aatgcgtatcttggcgcggcgcgtaacgaattgtttatttgttacgatttggattggcag
gtgatggattgtccgagcagtcgaacaggatattag

DBGET integrated database retrieval system