KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1725
Entry
NT05HA_1725       CDS       T00929                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00010  Glycolysis / Gluconeogenesis
aap00030  Pentose phosphate pathway
aap00051  Fructose and mannose metabolism
aap00680  Methane metabolism
aap01100  Metabolic pathways
aap01110  Biosynthesis of secondary metabolites
aap01120  Microbial metabolism in diverse environments
aap01200  Carbon metabolism
aap01230  Biosynthesis of amino acids
Module
aap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT05HA_1725
   00030 Pentose phosphate pathway
    NT05HA_1725
   00051 Fructose and mannose metabolism
    NT05HA_1725
  09102 Energy metabolism
   00680 Methane metabolism
    NT05HA_1725
Enzymes [BR:aap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NT05HA_1725
SSDB
Motif
Pfam: F_bP_aldolase TatD_DNase
Other DBs
NCBI-ProteinID: ACS98056
LinkDB
Position
1715347..1716426
AA seq 359 aa
MAKLLDLVKPGVLTGEDVQKVFAYAKEHGFAIPAVNCVGSDSVNAVLETAARVKAPVIIQ
FSNGGAAFYAGKGIKPTSGARPDVLGAIAGAKHVHTLAKEYGVPVILHTDHAAKKLLPWI
DGLLEAGEKHFAETGRPLFSSHMLDLSEEPMEENMAICREYLARMDKMGMTLEIEIGITG
GEEDGVDNSDVDESRLYTQPSDVLYVYDQLHLVSPNFTVAAAFGNVHGVYKPGNVKLKPS
ILGASQEFVAKERNLPAKPINFVFHGGSGSSREEIREAISYGAIKMNIDTDTQWAAWNGI
LNFYKANEAYLQGQLGNPEGPDAPNKKYYDPRIWLRKMEESMSKRLEQSFEDLNCVDVL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctaaattattagatctcgtcaaaccaggcgtgcttactggtgaagatgtacaaaaa
gtatttgcatacgcaaaagaacacggctttgccattcctgccgtaaactgtgtcggttcc
gactccgtcaatgccgtactagaaactgcagcacgcgtaaaagcacctgtaattattcaa
ttttctaacggcggtgcggcattctatgcaggtaaaggcattaaaccaactagcggtgcc
cgtcctgacgtgttaggtgccattgcaggagcaaaacacgttcatactttagccaaagaa
tacggcgtgccggtcattttacacactgaccacgcggcgaaaaaattacttccatggatc
gacggcttacttgaagccggtgaaaaacacttcgcggaaaccggtcgtcccttattctct
tcccacatgcttgacctttccgaagagccaatggaagaaaacatggcaatctgtcgcgaa
tatcttgcccgtatggacaaaatgggtatgactcttgaaatcgaaatcggtatcaccggt
ggtgaagaagatggtgtggataactccgatgtggatgaatcccgtctttacacccaaccg
tctgatgtgctttatgtttacgaccaattacatctagttagcccgaactttaccgttgcc
gcagcattcggtaacgtacacggtgtttacaaaccgggtaacgtgaaattaaaaccatct
attttaggcgcaagccaagaattcgtggccaaagagcgtaatctaccggcgaaaccaatt
aatttcgtcttccacggcggttccggttcttcccgtgaagaaattcgtgaagccatcagt
tacggtgcgatcaaaatgaacatcgataccgacacacaatgggccgcttggaacggtatt
ttaaacttctacaaagcgaacgaagcatatttgcaaggtcaattaggcaaccctgaaggc
cctgatgcaccaaacaaaaaatactacgatccacgtatttggttacgtaaaatggaagaa
tcaatgtctaaacgcttagaacaatctttcgaagacttaaactgtgttgatgttttataa

DBGET integrated database retrieval system