KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1726
Entry
NT05HA_1726       CDS       T00929                                 

Definition
(GenBank) RfaL protein
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00540  Lipopolysaccharide biosynthesis
aap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aap00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NT05HA_1726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aap01005]
    NT05HA_1726
Enzymes [BR:aap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     NT05HA_1726
Lipopolysaccharide biosynthesis proteins [BR:aap01005]
 Core region
  NT05HA_1726
SSDB
Motif
Pfam: Wzy_C
Other DBs
NCBI-ProteinID: ACS98057
LinkDB
Position
1716499..1717758
AA seq 419 aa
MQLSKQKSLSMIVNFTIGFFFLFLLNIKNGYNIAPALLIVLGLGYSIYGVIKKWRWSLSK
EDKMLIYSYLFYFATFVLSFIIHQGKIRELDNPSRVLLFIPVLLLLLHIPPRLNTVLYAI
PLGAIIAGITAIYDKLVLHSEMAFSVRIMHIQGGDIAMSLGMFSVAIGFYFFQKTQLKQT
TLCTFAGLCGILGSILSTARGGWIGVPFILILILWVYRQHLSKRFFLGLFSILIIAGFGI
NQLPNNRIAERVAAAEYDINAYLQRNDGSTSVGTRFDMWKSALLMAQEKPWLGWGVQGVS
EKRKQQFEQGLISQFASGFNHAHNQYFDDLSKRGIVGLLALIGVFFVPFYLFWRNLKSPH
AEMKLAGLLGVVHILSVMFYGMSQGFFSHNSGNIFYFFLVIVFYAFTKQQRLLAKHATV
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcaactatctaaacaaaaatcgttatccatgatagtaaattttactatcggctttttc
tttctattcctgttaaacattaagaatggatacaatattgcgccagcactacttattgta
ttaggcctcggttacagcatttatggcgtaataaaaaagtggcgatggtcgttatcaaaa
gaagataaaatgctgatctacagctatcttttttactttgccacattcgttctctcattt
attatccaccaaggaaaaatccgagaattggataatccaagtcgtgtattgctattcatt
ccagtgctgctattgctattgcatattccaccacgtctaaacacggtgctttacgcgatt
cctttaggtgcaattattgcaggcatcacagccatctatgacaagctggtattgcacagc
gaaatggcatttagtgttcgcatcatgcacattcaaggtggtgacattgcgatgtcactg
ggaatgtttagcgttgctatcgggttttatttttttcaaaaaacacaattaaaacagacc
acactttgcacctttgcaggattatgcggcatccttggcagcattctctctaccgcgcga
ggtggctggattggtgtgccgttcattctcatccttatactatgggtttatcgtcaacat
ctttcaaaacgattttttcttgggctatttagtattttaattattgccggctttggtatt
aaccagctaccgaataatcgcattgctgaacgtgttgccgccgccgaatatgacatcaat
gcttatttacaaagaaatgacggttctacttctgtcggtacgcgatttgatatgtggaaa
agcgcattattaatggcgcaagaaaaaccgtggctaggctggggtgtgcaaggcgtatca
gaaaagcgtaaacaacaatttgagcaaggcttaatcagccaatttgcgtcgggttttaat
cacgcccataatcaatatttcgacgatttatccaagcgcggaatagtaggtttattggcg
ttaatcggtgtgtttttcgtgccattttatctcttttggcgaaatttaaagagcccccat
gcagaaatgaaattagcaggattacttggtgtcgtgcatattctttccgtcatgttttac
ggcatgagccaaggttttttcagccataattccggcaatattttctatttctttttggtt
atcgtattttatgcgttcaccaaacaacaacgacttttagccaaacatgcaaccgtttaa

DBGET integrated database retrieval system