KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_2292Help
Entry
NT05HA_2292       CDS       T00929                                 

Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:aap00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NT05HA_2292
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aap03019]
    NT05HA_2292
   03016 Transfer RNA biogenesis [BR:aap03016]
    NT05HA_2292
Enzymes [BR:aap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     NT05HA_2292
Messenger RNA biogenesis [BR:aap03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     NT05HA_2292
Transfer RNA biogenesis [BR:aap03016]
 Prokaryotic type
  tRNA degradation factors
   NT05HA_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 OB_RNB HTH_12 S1 RNA_pol_Rbc25
Motif
Other DBs
NCBI-ProteinID: ACS98596
LinkDB All DBs
Position
2233228..2235633
Genome map
AA seq 801 aa AA seqDB search
MARKTRKSPPKDPNYAKELAKYDNPIPSREFILQIIREQNSPMSREEIFAALGISEGEQQ
EAMRRRLRAMENDGQLVFTKRKCYALPEKLDLLKGMVIGHREGFGFLHVEGKKEDFFIPN
VQMQKVMHGDYVLAQPNGFDRKGRPEVRIVRVLEANKKQIVGHFFFEQGIGYVVPDDSRI
TRDILIPDNARLGARMGQVVVVELHPRTAPFFQPIGKITEVLGDNMAKGMEVEIAIRKHD
IPHVFPSAVEKQLKKWAEDVPEEAKRGRVDLRDLPLVTIDGEGARDFDDAVFCQKQGKGW
KLWVAIADVSYYVRPKSALDQEAYNRGNSVYFPNRVVPMLPEKLSNGLCSLNPQVDRLCM
VCEITLSAKGKMTDYRFYEAVMNSHARLTYNKVAKILEKDTALCERYAPLVAHLQELHDM
YRTLVKARQQRGAIELETIESKFIFNALGRIERIEPVVRNDAHKIIEECMILANIAAANF
MEKNQESALYRIHDLPGEEKLTAFRGFLAECGLTLGGGNKPTPMDYAALLEQIQTRPDRE
LIQTMLLRSMSQAVYSADNIGHFGLALSEYAHFTSPIRRYPDLTLHRSIKYLLAKKKGSK
RKTTDTGGYHYQLDEMDVFGAHCSATERCADDATREVADWLKCEYMQDHVGEEFDGVISS
VTGFGFFVRLNDLFIDGLVHISGLANDYYLFDMPKQRLIGENSGMIFRIGDVVKVRVDAV
NLEQKQIDFVLIDSERKPRRSGKTARTKAKKAETAASKKSAKKQPFEKKKTKPQKSAVKN
NGVSKTKPQAAAKNKKAKNKA
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaaaactcgaaaatcccccccaaaagatccgaattacgcaaaagaattagcg
aaatatgacaatccgattccaagtcgtgaatttattttgcagattatccgtgagcaaaat
tctcctatgagtagagaggaaatttttgctgccttgggcatttccgaaggagaacaacaa
gaagccatgcgtcgtcgtttacgcgccatggaaaacgacgggcagttggtgttcaccaaa
cgcaaatgctatgccctaccggaaaagctagatttgcttaaaggcatggtgattgggcat
cgagaaggttttggttttttacacgttgaaggaaaaaaagaagacttttttattcccaac
gtacaaatgcaaaaagtcatgcacggcgattatgtgttggcacaaccaaatggctttgac
cgcaaaggtcgtccggaagtgcgtattgtgcgcgtattggaagccaataaaaaacaaatt
gtcggccactttttcttcgaacaaggcatcggttatgtggtgccggacgacagtcgtatt
actcgcgatattttaatccctgataatgctcgtcttggtgctcgcatggggcaagttgtt
gtggtggaactccatccgcgcacagcgccgttcttccagcctatcggcaaaatcaccgaa
gtgctcggtgacaatatggctaaaggcatggaagtagaaattgccattcgcaagcatgac
attcctcatgtattcccaagtgcggtggaaaaacaacttaaaaaatgggctgaagacgtg
cctgaagaggctaagcgtggccgtgtagatttgcgtgacttgcccttagtgaccattgat
ggcgaaggtgcccgcgattttgacgacgccgtattctgccaaaaacaaggcaaaggctgg
aaactgtgggtggcgattgccgatgtgagctattatgttcgaccgaaaagcgccttggat
caggaagcgtataatcgaggcaactctgtgtatttcccgaatcgggtggtgccaatgttg
ccggaaaagctctccaacgggctatgttccttaaatccgcaggtggatcggctgtgcatg
gtgtgtgaaatcacgctttccgctaaaggcaaaatgacggactaccgattttacgaagcg
gtgatgaactcccacgcccgtttaacttataacaaagtcgcaaaaatactggaaaaagac
accgcactttgcgagcgttacgcgcctctagtggcgcatttacaagaacttcacgatatg
tatcggacgctggtgaaagcccgtcagcagcgcggcgccatcgaacttgaaaccatcgaa
agtaaatttatttttaatgcgttggggcgtattgaacgtatcgaaccggtagtgcgcaat
gatgcccataaaatcattgaagaatgtatgattttggcgaatattgctgccgctaatttt
atggagaaaaatcaggaatctgcgttgtaccgcattcacgacttgccgggagaagaaaaa
ctcacggcgtttcgcggtttcctggcagaatgcggcttaacgctgggcggtggcaataaa
ccgacgccaatggattatgccgcgttgctggaacaaatccaaacgcgccctgatcgcgaa
ttaattcaaaccatgttgttgcgctccatgagccaggcggtgtatagcgccgacaacatc
gggcatttcggcttggcgttgagcgaatacgcgcattttacgtcgccgattcgtcgttat
cccgatttaactttgcatcgtagtatcaaatacttattggcaaaaaagaagggttccaaa
cgcaaaaccaccgacaccggcggttatcattatcagcttgacgaaatggatgttttcggc
gcccattgttccgccacggaacgttgtgccgatgacgctacccgagaagtggcggattgg
ctgaaatgcgaatatatgcaggatcatgtgggcgaagaatttgacggcgtgatttcctcc
gtcaccggttttggctttttcgtccgcttaaacgacttatttattgacggcttggtacat
atttccgggctggcgaacgattattatttgttcgatatgccgaaacagcgtcttatcggt
gaaaatagcggcatgattttccgtatcggcgatgtggtgaaagtgcgggtggacgcggtg
aatctggaacaaaaacaaattgattttgtcctgattgacagtgaacgtaaaccaagacgc
agtggcaaaacggcgagaaccaaagcgaagaaagccgaaaccgcagcctctaaaaagtca
gcgaaaaagcaaccctttgaaaagaaaaaaacgaaaccacagaaaagtgcggtcaaaaat
aatggcgtttctaaaacgaaaccgcaagccgcagctaagaataagaaggcgaagaacaaa
gcatga

DBGET integrated database retrieval system