KEGG   Arthrobacter alpinus R3.8: AOC05_02155Help
Entry
AOC05_02155       CDS       T04095                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq00020  Citrate cycle (TCA cycle)
aaq00480  Glutathione metabolism
aaq01100  Metabolic pathways
aaq01110  Biosynthesis of secondary metabolites
aaq01120  Microbial metabolism in diverse environments
aaq01130  Biosynthesis of antibiotics
aaq01200  Carbon metabolism
aaq01210  2-Oxocarboxylic acid metabolism
aaq01230  Biosynthesis of amino acids
Module
aaq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOC05_02155
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOC05_02155
Enzymes [BR:aaq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AOC05_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALE91433
UniProt: A0A0M4RM59
LinkDB All DBs
Position
504131..506347
Genome map
AA seq 738 aa AA seqDB search
MAKIIYTHTDEAPMLATYSLLPIVEAFASTAGVDIETRDISLSARIISVFGDYLAEDQRI
ADALAELGALAKDPDANIVKLPNVSASIPQLKTAIAELQGQGYALPSYPDDPSTDEEKNV
RARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARANPHTMGAWSADSKTNVATMSNGDFR
HNEKSVVIAADCMIKIQFVAADGTVTVLKDAFAVLADEVVDGTVMRAAALDEFLTAQVAR
AKAEGVLLSAHLKATMMKVSDPIIFGHVVKAYFPELFANYGDALAAAGLSPANGLASILN
GLDALPAEVREGIEAAIKKGYDDGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGADNQEHDTLAVLPDSSYAGVYQVTIDDCRKHGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFELSEAGTVQIVNSAGEVLIEHNVDTGDIWRACQVKDIPVRDWVKLAVTRARASMT
PAIFWLDETRAHDANLITKVTEYLKDYDTQGLDIRIMSPEEATAFTLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLIAGGGLFETGAGGSAPKHVQQLIKENHLRWD
SLGEFLALAVSFEHLAVTKGNARAQILADTLDRATGTFLLENKSPKRRVGEIDNRGSHFH
LAKFWAQELAAQNDDAQLATAFASVAKELTDNEDVIIGELAAVQGSPVDLGGYYHPDEAK
VAAIMRPSVTLNKIIATL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattatctacacccacaccgacgaagcgcccatgttggcgacctattcattg
ctcccgatcgttgaggccttcgcctccacggcaggcgttgacatcgagactcgcgacatt
tcgctgtccgcccgcatcatctccgtctttggcgactacctcgccgaggaccagcgcatc
gcagacgcactcgccgaactcggcgcactggccaaggatcccgacgccaacatcgtcaag
ctgcccaacgtcagcgcctccatccctcagctcaagacggccatcgccgaactacaaggc
cagggctacgcgcttccgagctacccggatgacccctccactgacgaggaaaaaaacgtt
cgcgcccgctacgacaagatcaagggcagcgccgtgaacccggtgctgcgcgaaggcaac
tcggaccgccgtgcgcccctgtcagtgaagaattacgcccgcgccaacccgcacaccatg
ggcgcctggtccgctgactccaagaccaatgtcgccaccatgagcaacggcgacttccgc
cacaacgagaagtccgtggtcatcgccgccgattgcatgatcaagatccagtttgttgcc
gccgacggcacggtcacagtgttgaaggacgccttcgcagtgctggcagatgaggtcgtg
gacggcaccgtcatgcgtgctgccgccctggatgagttcctcaccgcccaggtggcccgc
gccaaggcagaaggcgtcctgctctccgcgcacctgaaggccaccatgatgaaggtctcg
gaccccatcatcttcggccacgtcgtcaaggcgtacttcccggaactgttcgccaactac
ggcgacgcactggccgccgccggcctgagcccggccaacggcctggcgtccatcctcaac
ggcctggacgccctgcctgcagaggttcgcgagggcatcgaagccgccatcaagaaggga
tacgacgacggtcccgccttggcaatggtcgattccgataagggcatcaccaacctgcac
gtaccctccgacgtgatcgtggacgcctccatgccggccatgatccgcacctccggccac
atgtggggcgcggacaaccaggagcatgacaccctggccgtcctgccggacagcagctac
gccggcgtctaccaggtgaccattgatgactgccgcaagcacggcgcgttcgatccgacc
accatgggcaccgtcccgaacgtgggcctcatggcccaggccgccgaggaatacggcagc
cacgacaagaccttcgagctcagcgaagccggcaccgtgcagatcgtcaacagcgccggc
gaggtcctgatcgagcacaacgtcgacaccggtgacatttggcgcgcctgccaggtcaag
gacatccccgtccgcgactgggtcaagctggcggtcacccgtgcccgcgcctccatgact
ccggccatattctggctggatgagacgcgcgcccacgacgcgaatttgatcaccaaggtc
accgaatacttgaaggactacgacacgcagggcctggacattcgcatcatgtccccggaa
gaggcaaccgccttcaccctggagcgcatccgccgcggcgaagacaccatctccgtcacc
ggcaacgtgctccgcgactacctcacggacctgttcccgatcctggaactgggcaccagc
gccaagatgctctcgatcgtgccgctaatcgccggaggaggcttgtttgagaccggcgcc
ggtggttctgccccgaagcatgtgcagcagttgatcaaggaaaaccacctccgttgggat
tccctaggagagttcctggccctggccgtgagcttcgagcaccttgccgtcaccaagggc
aacgcccgcgcgcagatccttgccgacaccctggaccgcgccaccggtacgttcctgttg
gagaacaagtcccccaagcgcagggtcggcgagatcgacaaccgcggcagccacttccat
ctcgccaagttctgggcacaggaattggccgcccagaacgacgacgcgcagctggctacg
gcgtttgcctccgtggccaaggagctcactgacaacgaggatgtcatcattggtgagctc
gccgctgttcagggctccccggtcgacctgggcggctactaccacccggatgaggccaaa
gttgccgccatcatgcgcccgtcggtgacgctgaacaagattatcgccacactgtaa

DBGET integrated database retrieval system