KEGG   Arthrobacter alpinus R3.8: AOC05_04620Help
Entry
AOC05_04620       CDS       T04095                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aaq  Arthrobacter alpinus R3.8
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aaq01001]
    AOC05_04620
Enzymes [BR:aaq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AOC05_04620
Protein kinases [BR:aaq01001]
 Serine/threonine kinases: Other
  Bacterial family
   AOC05_04620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH DUF2232 Kinase-like Pkinase_fungal Haspin_kinase Kdo DUF3040 DUF667
Motif
Other DBs
NCBI-ProteinID: ALE91770
UniProt: A0A0M5M2X7
LinkDB All DBs
Position
complement(1072719..1074851)
Genome map
AA seq 710 aa AA seqDB search
MVQDVPNDPLIGSTIDDRYLVLSKVARGGMSTVYLAKDVRLNRNIALKILHPHLATDNAF
IERLQREAWSAASLSHPHVVQIHDHGAGAAHAYLVLEYIDGHTLRDVINKEHALTPRQAL
DLLDPIVEGLAAAHAAGLVHRDVKPENVLISRSGWVKIGDFGLSRAVTTTTNTGTLLGTV
GYIAPELVNGEGGDARSDIYSAGIMLYELLTGEQPFHGQVPIAVAMAHVRDAVPAPSTIV
PGLPAEMDELVRYMTEKDPDNRPANGASLLEDLRHIWATLTPAELDAGGSKDSSAPEFAA
GPSAAADTAALTSALGRVEDQAAGTDVIEISGDSRATTVITAPTYPTSILPASSRLYVDD
TESAVPGVGPDAFGDYDSDDAASGQALSKREARAEAKTRAKAAAQPTKTLGTGHPRRRAI
IWVAVVVVLGILAAFAGWFLALGPGALATVPDVHNKSVTQAQKLLNEQGFERLPTTDVFD
ELVAAGTVVDTDPAAGASQRRFLGVTMHVSRGPVLYNVPQVAGKPLPEATTALTDAHLAL
GTVAEAFDEKVPAGIVLSQDPPTGTEFRNGTKVNLAVSKGPTPIPVPSVVGKTDAAAKTA
LKDLGLVPAIAPEQLNSPTVPAGSVLSQTPESGNLTAGGTVTLTLSKGPKMVKVPDMVGK
QAGAATAELKALGFNVSVENLLGGFFGTVRFQDPQGGEAPEGSIITLKVI
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagatgtgcctaacgaccccttgatcgggtccacaatcgatgaccgctacctg
gtgctttccaaggtggcgcgcggtggcatgtccaccgtctatctcgccaaagacgtgcgg
ctgaacagaaacatcgcgctaaaaatcctccacccccatctggccaccgacaacgccttt
atcgagcggttgcaacgcgaggcgtggagtgccgccagcctgtcgcacccccacgtggtg
cagattcacgaccatggcgccggggccgcccacgcatatctggtgttggaatacattgac
gggcacacactgcgcgacgtcatcaacaaagaacacgccctgactccgcggcaggccctt
gacctgcttgaccccattgtggagggactcgcggctgcccatgcggccgggctggtccat
cgggacgtgaaaccggagaacgtgctgatttcccgcagcggctgggtgaaaattggcgat
tttggcctctcacgagccgtcaccacgaccacgaacacggggacacttctaggtaccgtc
gggtacatcgcccctgaactggtcaatggtgagggcggcgacgcccgcagcgacatatat
tctgccggaatcatgctctacgagttattgacaggtgaacagcccttccacgggcaggtt
cccatcgctgtggccatggcccatgtccgcgatgccgttccggcgccctccaccatcgtg
ccgggcctgccggcagaaatggacgaactggtccgctacatgacggagaaggaccccgac
aatcggccagccaacggggcgtccctcctggaggacttgaggcatatttgggcaaccttg
acacccgcggagcttgacgctggcggctcgaaggatagttcagcaccggagtttgccgct
ggcccgtcagcggcggctgacactgcggccctgacatccgcccttggccgggtagaggac
caagctgctggtaccgatgtcatcgaaatctccggcgactcccgcgccacaactgtcatt
acagcacccacctatcccacgagtatcctccctgccagcagccgcctgtacgtggatgac
acagagtctgccgtgcccggcgtcggccctgacgcctttggtgactacgactccgacgac
gccgcctctgggcaggcgctttccaagcgggaggcccgcgccgaggccaagacgcgggcc
aaggccgctgcgcagccaacgaagaccctgggcaccggacatccccgacgacgtgccatc
atctgggtggctgtggtggtggtcctgggaatactcgcagcatttgccggctggttcctg
gccttgggccccggcgccttggcgaccgtgcccgatgttcacaacaaatccgtcacacag
gcccagaagctgctgaacgagcagggctttgagcgactccccaccaccgacgtctttgac
gaactagttgccgcgggaacggtggtggacacggaccctgccgcaggtgcgtcgcaacgt
aggtttctcggcgtgaccatgcacgtctcacggggaccagtgctgtacaacgttccccag
gtagctggcaagccgttgccggaggccacaactgccctcaccgacgcacatctggccctt
ggcaccgtcgctgaggccttcgacgagaaggtccctgcaggcatcgtcctgagccaggat
cccccgaccgggaccgagttccgcaacgggaccaaggtcaaccttgcggtctcgaaggga
cccacacccatccctgtcccatcggtggttggcaagaccgacgccgctgccaagacggcg
ctgaaggatcttggcctcgtgccggccatcgcccccgaacagctcaacagtcccacagtg
cctgccggctccgtgctctcccagaccccggaatccggcaatctcacagctggcggcaca
gtcaccctgactctgtccaagggccccaagatggtcaaggtgccggacatggtgggcaaa
caggcaggcgccgctaccgcagaactcaaggctctgggcttcaacgtttccgtggagaac
ctcctgggcggcttctttggcaccgtccgtttccaggacccacaaggcggggaagccccc
gagggcagcatcatcaccctaaaggtcatctag

DBGET integrated database retrieval system