KEGG   Arthrobacter alpinus R3.8: AOC05_05820Help
Entry
AOC05_05820       CDS       T04095                                 

Definition
(GenBank) phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq00010  Glycolysis / Gluconeogenesis
aaq00030  Pentose phosphate pathway
aaq00051  Fructose and mannose metabolism
aaq00052  Galactose metabolism
aaq00680  Methane metabolism
aaq01100  Metabolic pathways
aaq01110  Biosynthesis of secondary metabolites
aaq01120  Microbial metabolism in diverse environments
aaq01130  Biosynthesis of antibiotics
aaq01200  Carbon metabolism
aaq01230  Biosynthesis of amino acids
Module
aaq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOC05_05820
   00030 Pentose phosphate pathway
    AOC05_05820
   00051 Fructose and mannose metabolism
    AOC05_05820
   00052 Galactose metabolism
    AOC05_05820
  09102 Energy metabolism
   00680 Methane metabolism
    AOC05_05820
Enzymes [BR:aaq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AOC05_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ALE94024
UniProt: A0A0M5LYB5
LinkDB All DBs
Position
complement(1322020..1322991)
Genome map
AA seq 323 aa AA seqDB search
MDSFPTILATPILTLTMNPALDVSTSTDLVYSDHKLRCQGSHMDPGGGGANVARVIHRLG
GHVLAIYTAGGTTGDTYRKLMEAQGIPAVVAAVRGNTRQNFTVDENSTGKQFRFVLEGTE
LSEDEWRNCLQLVQRSIRAGGYVVASGSLPPGVPDDFYARVARLARNADARCVVDTSGPA
LAEALAEGVFLIKPSRRELAEHAGTALDTEESQIAAAAELTGQGSAEYVALTLADAGAVL
ASKAGICRLQVPPVRVVSTVGAGDSFLAAFVLRLAQGYPAEVALRSAVAAGTAAVLTPAT
ELCHRADVERFETEIAARTDTPR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttccccacaattctcgccacaccgatcctgaccctcaccatgaatcctgca
ttggacgtgagtacctcaacggacctcgtttacagcgaccacaagcttcgctgccaggga
agccatatggacccgggaggcggaggggccaacgttgccagggttatccaccggctcggc
ggccacgtcttggctatttacacagcaggcggtaccaccggagacacttaccgcaagctg
atggaagcccaagggattcccgccgtcgtggcggccgtgcgtgggaacacccggcaaaac
tttacggtcgatgagaattcaaccggcaaacaattccgattcgtccttgaaggtaccgaa
ctcagtgaagacgagtggcgcaactgcctgcagctggtccagcgctccatccgtgcaggc
ggctatgtcgtcgccagcggcagcctgccgcccggggtccccgacgacttctacgcccgc
gtcgcccgcctggcacgaaatgccgacgcacggtgtgttgtggacacctcgggaccggcg
ctcgcggaagccttggccgaaggcgtgtttttgattaagcccagccgccgggagttggct
gaacatgccggaaccgctcttgacaccgaggagagccagatcgctgcggccgcagagctg
acgggccaaggttccgccgaatatgtcgccctgaccctggccgatgctggagccgtgctc
gcctccaaggcagggatctgccgcctgcaggttcccccggtacgggtggtcagcactgtc
ggcgccggcgacagcttcctggccgccttcgtgctgcggcttgcccaaggatacccggcc
gaggtggccctgaggtcggcggttgcggcaggaactgcagccgtcctgacaccggccacc
gaactgtgccaccgcgccgacgtcgaacggttcgagacggaaattgcggccagaaccgac
acgcccaggtga

DBGET integrated database retrieval system