KEGG   Arthrobacter alpinus R3.8: AOC05_09495Help
Entry
AOC05_09495       CDS       T04095                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq00473  D-Alanine metabolism
aaq00550  Peptidoglycan biosynthesis
aaq01100  Metabolic pathways
aaq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOC05_09495
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOC05_09495
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AOC05_09495
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaq01011]
    AOC05_09495
Enzymes [BR:aaq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AOC05_09495
Peptidoglycan biosynthesis and degradation proteins [BR:aaq01011]
 Precursor biosynthesis
  Amino acid ligase
   AOC05_09495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ALE92493
UniProt: A0A0M4RBS4
LinkDB All DBs
Position
complement(2121928..2123064)
Genome map
AA seq 378 aa AA seqDB search
MTTDSPAPTPRIRVAILFGGRSSEHAVSCVTAAGVLGAIDRGKYDVVAIGIAKNGQWVLA
GDEVSGWSLAGGALPEVKAGGQSVSLAHLGGGHQLVVQEAAQVPQELGVVDVVFPLLHGP
WGEDGTIQGMLELSDTRYVGAGVLASAIGMDKHFMKVVFEAAGLAVGPFIAVTDREWTVN
PGRVRDRVSALGFPVFVKPARAGSSMGISKVDSVDGLDAAIAAAREHDLKLVIEAGIVGR
EIEIAVLEGRGSAAPRVSLPGEVTMMDGTHHAFYDFEAKYVHGDAVTLSCPADMPEVDLA
RIREQAALAFDAVGAEGLSRVDFFYTAAGDLIINEINTMPGFTPSSMYPQMWAASGLSYR
DLIDELVQLALTRKVGLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgactactgattcccccgccccaacaccgcgcattcgtgtcgccatcttgtttggcggg
cgctccagcgagcacgccgtcagttgtgtcactgccgccggcgtgttgggcgccatcgac
cgtggaaagtacgacgtcgtcgccatcggtatcgcgaaaaatggccagtgggttttggct
ggggacgaggtttctgggtggtcgttggcgggcggagcactgccggaggtcaaggcgggg
gggcagagcgtttcgctggcacaccttggtggtggacaccagctggtggtgcaggaagca
gcccaggttccgcaggaattgggggtcgtggatgtggttttcccgctgttgcacggaccg
tggggcgaggatggcaccatccagggcatgctggaactaagcgatacccggtacgtgggt
gcgggtgttttggcgtcggccattggtatggacaagcatttcatgaaggtggtttttgaa
gcggccggactggctgtggggccgttcattgcggtgaccgaccgagagtggaccgtcaat
cccgggcgtgtgcgcgatcgggtttccgctcttggcttccccgtgtttgtgaagcctgcc
cgcgccggatcctccatgggcatctccaaggttgattcggtcgacgggctggatgccgcg
attgccgcggcacgtgagcacgatctcaagctggtcattgaggctggcattgtgggccgc
gaaattgaaattgccgtcctggagggccgggggagcgctgcccctcgcgtctcgctgccg
ggcgaagtcaccatgatggatgggacccatcacgcgttttacgattttgaggccaagtac
gtccacggcgacgcagtgacgctgagctgcccggcggacatgcccgaagtagacctcgcc
cgaatccgggaacaggcagcactcgcgtttgacgccgtcggggccgagggcctgtcccgg
gtggacttcttctacaccgcggccggggacctgatcatcaatgaaatcaatacgatgccc
ggtttcacgcccagctccatgtacccgcagatgtgggccgcgtccgggctgtcctaccgg
gacctcatcgacgagcttgtgcaactggcactgacccgtaaggttggcctgcgctaa

DBGET integrated database retrieval system