KEGG   Arthrobacter alpinus R3.8: AOC05_12430Help
Entry
AOC05_12430       CDS       T04095                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aaq  Arthrobacter alpinus R3.8
Pathway
aaq00564  Glycerophospholipid metabolism
aaq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AOC05_12430
Enzymes [BR:aaq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AOC05_12430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 DnaG_DnaB_bind SRP_SPB 3HCDH_N AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ALE92918
UniProt: A0A0M4RCL9
LinkDB All DBs
Position
complement(2769004..2770743)
Genome map
AA seq 579 aa AA seqDB search
MNHSTHPNGNLDPAAREASLKALKSTVAPGKELDILIVGGGVVGAGAALDAVTRGLNVGL
VEANDWAAGTSSRSSKLIHGGLRYLEMLDFALVQEALQERGLLIQRIAPHLVRPVPFLYP
LTRRFVERPYVGAGILLYDTLGVTSGNSRGVPMHKHLTRRGTLRAAPSLKDDAMIGSIRY
YDAQVDDARLVTNVIRTAASFGAHVANQTEVIDFLREGQRVVGAKVRNLEDGTEFEIRAK
QVINATGVWTDETQAMVTDRGQLKVRASKGIHLVVPRDRFQSTVGLILKTEKSVLFVIPW
GRHWIIGTTDTDWKLDKAHPAASSKDIDYLLGHVNKVLKRPLTREDVEGVYAGLRPLLAG
ENDSTAKLSREHVVAHPVPGLVVVAGGKLTTYRVMAKDAVDEATRSLDEKVPDSCTDTIP
LLGASGFKASWNRRTKMADESGIHVERVEHLLNRYGAMAQDVLDLMVASPELAQPLPGAD
DYLGAEVVYAATHEGALHLADVLTRRTRISIEAWDRGVAAAPVVARLMGDILGWSETQRE
NEVANYLARVEAERLSQQQPDDESADAARLGAPGIVPLM
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattcaacccaccccaacggcaacttggacccagcggcccgtgaagcctcgctc
aaggccttgaaatccacagtggcgcccggcaaggaactggatattttgatcgttggcggc
ggggtggtcggtgccggcgcggcactggacgccgtcacccgcggcctgaacgtggggctt
gtggaggccaacgactgggctgcggggacgtcgtcgcgctcgtcaaaactgattcacggc
gggctgcgctacctggagatgcttgacttcgcactggtgcaggaggctctgcaagaacgc
gggctgctgatccagcgcatcgcgccgcacttggtgcgtccggtaccgtttttgtacccc
ctgaccagacgattcgtggagcgcccctacgtgggggctgggatcctgctgtacgacacg
ctgggcgtgaccagtggcaacagtcgcggcgtccccatgcataagcacctcacacgccgg
ggcacactgcgggctgcccccagcctgaaggacgacgccatgatcggctccatccgctac
tatgacgcgcaagtggacgacgcgcggttggtcaccaacgtgatccgcacggctgccagc
tttggcgcccacgtggccaaccaaacggaggtgatcgacttccttcgggagggccagcgc
gtggtcggagccaaggtccgcaatttggaggacggcaccgaatttgagatcagggccaag
caggtcatcaacgccacgggtgtctggacggacgaaacccaggcgatggtcaccgaccgc
ggccagctcaaggtcagggcctcaaaaggcatccacctggtggtgccgcgggacaggttc
cagtcaacggtgggcctgattttgaagaccgaaaagtcggtcttgttcgtcatcccgtgg
ggtaggcactggatcattggtacgacggacacagactggaaactggacaaggcccacccc
gcagcctccagcaaggacatcgactatctgcttggacatgtcaacaaagtactcaagcgc
cccctcacccgcgaagacgtcgaaggagtctatgccggcctccgtcccctgctggcgggc
gagaatgactcaaccgccaagctttccagagaacacgtcgtggcccatcccgtccccggt
ctggtggtggtcgccggaggaaagctcaccacgtacagggtcatggcgaaggacgccgtg
gatgaggccacccgcagcttggatgaaaaggtgccagacagttgcacggataccattccg
ttgctcggcgcctccgggttcaaggccagctggaaccggcggaccaagatggccgatgag
tccggcatccatgttgagcgggtggagcacctgctcaaccgctacggggccatggcacag
gacgttctggacctgatggtggcctcgcccgagctggcgcagccacttccgggtgccgac
gattacctaggggctgaggtggtgtatgccgccacccatgagggcgcgctgcatctggct
gacgtactgacccgccgcacccgtatttctatcgaggcgtgggaccgcggggtcgcggcg
gcccccgtagtggctagactaatgggggatattttggggtggagtgaaacccaacgggaa
aatgaagtggccaactacttggcccgggtcgaggccgagcggctcagtcagcagcagccc
gacgacgaatcggcggatgctgcccggctcggggctccgggcattgttccgctcatgtag

DBGET integrated database retrieval system