KEGG   Alcaligenes aquatilis: D3M96_07250Help
Entry
D3M96_07250       CDS       T05678                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00564  Glycerophospholipid metabolism
aaqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D3M96_07250
Enzymes [BR:aaqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D3M96_07250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Thi4 Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3 FAD_binding_3 Pyr_redox XAF1_C GIDA GMC_oxred_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AYN20338
UniProt: A0A3G2HUC3
LinkDB All DBs
Position
1599623..1601221
Genome map
AA seq 532 aa AA seqDB search
MTTLSSPLLTDRAQMMGALARTTQADMVVVGGGATGLGVALDAALRGLSVVVLEARDFAK
GTSSRATKLVHGGVRYLAQGNVSLVREALRERMHLLSNAPHLAQRLPFVMPSYKCWETPF
YGVGLMAYDGLAGREGLGHTQFLSASKIRQLLPGARQSGLKGGVKYWDGQFDDARLALAL
ARTAALNGALLVNYCPVVEVMHRDGKVSGVRCQDGESGQTYTIQSHCVVNATGVWVDQVR
ELDAREAGRQLRPMVSPSQGVHLVVDQTFLPGEHALLVPRTKDGRVLFAVPWLGKLILGT
TDTPRDDVPLEPRPMAQEVDFILKESANYLQKAPTARDVRSIWVGLRPLVRPAAESAAGK
TQSISREHSITVSTNGLLTVTGGKWTTYRAMAEDVLERCQQSGLLGPLPACRTQEQRLVG
ASYVGDRRSLGRTAGLDAYGSEADWVQTLPGADQELAPGLSVAMVRFACRFEYARTVEDM
LARRSRLLFLDARLAQSLAPAVAAIIQEETGRSPELDAFLALAEQYATVPTC
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactacattaagttcccccttattaaccgatagagcccagatgatgggcgccttggcg
cgcaccactcaggcggatatggtcgtggtggggggcggggcaaccggcctgggtgtggcc
ctggacgcggccctgcgcggcttgagtgtggtggtgttggaagcccgggattttgccaag
ggcacgtcctcgcgggccaccaagctggtacacggcggggtgcgttatctggctcagggc
aacgtcagcttggtacgcgaggccttgcgcgaacgcatgcatttgctcagtaatgcgccg
catctggcccagcgcctgccttttgtcatgcccagctacaaatgctgggaaaccccgttt
tatggggtcggcttgatggcgtacgacggtttggcagggcgggaagggctgggccatacc
cagtttctgagcgcttctaaaattcggcaactgttgccgggtgcccgtcaaagtggcttg
aaaggcggtgtgaaatattgggatggtcagtttgacgatgcgcgtctggctttggccctg
gcccgtacggcggccttgaatggtgccttgctggtcaattactgcccggttgtagaagtg
atgcaccgcgacggcaaggtgtccggggtgcgctgccaggacggagaaagtggtcaaacc
tatacgatccagagtcactgcgtggtcaatgccacgggggtgtgggtggatcaggttcga
gaactggatgcgcgggaagccgggcgtcaattgcggcctatggtctcgcccagtcagggg
gtgcacttggtggtcgatcagacatttctgcccggtgaacacgccttgctggtgccgcgt
accaaggatggccgggtactgtttgccgtgccttggctgggcaagctgattctgggaacc
acggataccccccgggatgatgttcctttggagccgcgccctatggcccaggaagtggat
ttcattctgaaagaatcggcgaattatctgcaaaaagccccgactgcgcgggacgtgcgc
agtatctgggtaggcttgcggcccttggtgcgcccggctgccgagtcggctgcggggaaa
acgcaatcgatcagccgggaacacagtattacggtgagcaccaatggtttattgacggta
acgggtggcaagtggacaacgtaccgagccatggctgaggatgtgctggaacgttgccag
cagtccggtttgctggggcctttgcctgcctgccggactcaggaacaacgcttggtaggt
gcttcttatgtaggcgatcggcgctctttggggcgtaccgctggcctggatgcttatggc
agtgaggctgattgggtgcagaccttgcccggagccgatcaagagctggctccaggcctg
agcgtggccatggtgcgctttgcctgccgctttgaatatgcccgtaccgtggaagacatg
ctggcccgtcgttctcggcttttgttcctggatgcgcgcctggcgcaatcacttgccccg
gcggtggcggcgattatacaagaggaaacggggcgttcgcccgaactggatgcttttctg
gcgttggccgagcaatacgccaccgtgccgacgtgctag

DBGET integrated database retrieval system