KEGG   Alcaligenes aquatilis: D3M96_09920Help
Entry
D3M96_09920       CDS       T05678                                 

Definition
(GenBank) hypothetical protein
Organism
aaqu  Alcaligenes aquatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Apolipoprotein ApoLp-III Borrelia_P83 UPF0242 YtxH DUF883 Mitofilin DUF3807 DUF4208 DUF1451 CdvA
Motif
Other DBs
NCBI-ProteinID: AYN20812
UniProt: A0A3G2HUH0
LinkDB All DBs
Position
2171639..2172124
Genome map
AA seq 161 aa AA seqDB search
MKLTRAHFAVMAAAASMTLLAACSKEDDKAASSAPPAPVAAPQSTAPATAPAPEADKSME
QKTEELKQDAAKVAEDVKKEAEEQKENAKENANSLKEDAKAAGDKIAEKADEAKDAMAEA
ASRTGDAIKEGAAKADKAIQDKLGNGVDSSPSSVPSEQAKP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactcgtgctcattttgctgtcatggccgctgctgcttcgatgactcttttg
gctgcgtgttccaaagaggacgataaagccgcttcgagcgcgccaccggctcctgtcgct
gcgccacaatcgacggcgcctgccactgcacctgctcccgaagctgacaaatccatggag
caaaaaacggaagagttgaagcaggacgccgctaaagttgctgaagacgtcaaaaaagaa
gcagaggaacagaaagaaaacgccaaggaaaatgctaactccttgaaggaagatgccaag
gctgctggcgataaaatcgctgaaaaagcagacgaagccaaggacgctatggctgaagct
gccagccgtactggtgatgcgattaaagaaggcgcagccaaagctgataaagccattcag
gacaaactgggtaatggtgttgactcttcaccatcttccgttccttcagaacaagccaaa
ccttaa

DBGET integrated database retrieval system