KEGG   Alcaligenes aquatilis: D3M96_12135Help
Entry
D3M96_12135       CDS       T05678                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aaqu  Alcaligenes aquatilis
Pathway
aaqu00250  Alanine, aspartate and glutamate metabolism
aaqu00410  beta-Alanine metabolism
aaqu00430  Taurine and hypotaurine metabolism
aaqu00650  Butanoate metabolism
aaqu01100  Metabolic pathways
aaqu01110  Biosynthesis of secondary metabolites
aaqu01120  Microbial metabolism in diverse environments
aaqu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aaqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D3M96_12135
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D3M96_12135
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D3M96_12135
   00430 Taurine and hypotaurine metabolism
    D3M96_12135
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D3M96_12135
Enzymes [BR:aaqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     D3M96_12135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AYN21207
LinkDB All DBs
Position
2664749..2666143
Genome map
AA seq 464 aa AA seqDB search
MNESVKDSPLAFDDVYASKELSNSLPKSRFPDKEEDPRNVFNAVRDELMLDGNSRQNLAT
FCQTWVDDEIRDLMALSIDKNMIDKDEYPQTAEIERRCVAMLADLWNSPEAETTLGCSTI
GSSEAAMLGGLALKWQWRKKRKTAGKPSDRPNLICGPVQICWHKFARYFDVELREIPLEG
DRLIMSPEEVIKRVDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQAETGLDIPIHVDG
ASGAFLAPFCAPDIQWDFRLPRVKSINSSGHKFGLAPLGAGWVVWRESKDLPEELIFNVN
YLGGDMPTFALNFSRPGGQVIAQYYNFLRLGREGYTKIHNACYATAQYLSAEIAKMGPFE
ILFNGDSQKGIPALAWKLKEGKVTGGYTLYDLADRLRSRGWQVPAYSMPAHREDLVVQRI
LVRHGVSMDLASLLLDDMRRAIDYFKKHPVSAPLSQEEGGGYSH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatcagttaaagacagccccttggccttcgacgatgtctacgcgtcaaaggaa
ctttccaatagcctgcctaaaagccgtttcccagataaagaagaagatcctcgaaacgtc
tttaatgctgtccgggacgagttgatgctagacggcaattcccgacagaaccttgcaacg
ttttgccaaacctgggttgatgacgaaatccgcgacctcatggctctgtcgatcgacaag
aatatgatcgacaaggacgagtatccccagacggcagagattgaacgtcgctgcgtcgca
atgctggccgacctctggaattcacccgaggctgaaaccaccctggggtgctccaccatc
ggctcttccgaagccgccatgctcggtggccttgccctaaaatggcagtggcgaaagaag
cgtaaaacagccggcaagccctcggaccgacctaacctcatctgcggcccggttcaaatt
tgttggcacaagtttgcgcgctactttgacgtggagctgcgcgaaatccccctggagggc
gaccgtctgatcatgagcccggaggaagtgatcaagcgcgtagacgagaacactatcggc
gtagtgcccacgctcggtgtgacattcacctgccaatatgaaccggtcaaagcagttcac
gacgcactcgacaagcttcaggccgaaacaggtcttgacattccgattcacgtcgatggg
gccagcggcgcttttctagcgccgttttgcgctcccgacattcaatgggatttccgtcta
ccccgcgtcaagtcgatcaactcgtctgggcacaagtttggcttagcgccactcggggca
ggttgggtggtctggcgcgagtccaaagacctgcccgaagaactgattttcaacgtcaat
taccttggcggagacatgcctacctttgcgctgaacttctctcgtccgggcggacaagtt
atcgcccagtactacaactttctgagacttggccgggaaggatacacaaaaattcacaat
gcttgctacgcaaccgcacagtacctctcggccgagattgccaagatggggccgttcgag
atcctgttcaatggtgatagccaaaagggcattccggcgctggcatggaaactcaaagag
ggcaaggtgaccggtggctacaccttatacgaccttgccgaccggctacgcagtcgggga
tggcaagttcctgcatactcaatgccagctcatcgtgaagacttggtagtacagcgtatt
ctggtgcgccacggggttagtatggacctggcatcactgcttctcgatgatatgcgccgc
gccatcgactacttcaagaagcatccggtgtctgccccattgtcccaagaggaaggcggc
ggctacagccactga

DBGET integrated database retrieval system